DUF1788 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1788 - Domain of unknown function (DUF1788)

PFAM:	PF08747	Sequences: EINLYDLLIEILEERGLLEKILEMEKEKGKDALLEALQGVLDPEDKLAPRIAEKLEEDERDVVFLTGVGALFPFIRSHTLLNNLQGVVKDVPTVLFYPGEYDGQSLRLFGKLKDDNYYRAFNL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	123 (122)
Sequences:	4114 (2647)
Seq/√Len:	239.6
META:	0.907

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
3_N	70_A	4.083	1.00
100_E	110_G	3.013	1.00
102_D	107_R	2.700	1.00
13_E	18_L	2.660	1.00
50_R	54_K	2.623	1.00
1_E	66_T	2.617	1.00
77_S	95_L	2.321	1.00
50_R	53_E	2.269	1.00
10_E	14_E	2.146	1.00
18_L	22_L	2.125	1.00
65_L	95_L	2.055	1.00
52_A	87_V	2.027	1.00
15_R	20_K	1.995	1.00
52_A	56_E	1.915	1.00
6_D	10_E	1.873	1.00
5_Y	9_I	1.844	1.00
68_V	95_L	1.769	1.00
17_L	20_K	1.763	1.00
9_I	18_L	1.754	1.00
10_E	50_R	1.640	1.00
107_R	110_G	1.564	1.00
49_P	53_E	1.541	1.00
102_D	105_S	1.515	1.00
9_I	13_E	1.501	1.00
55_L	63_V	1.496	1.00
10_E	13_E	1.483	1.00
4_L	68_V	1.483	1.00
25_E	30_K	1.468	1.00
64_F	96_F	1.432	1.00
64_F	94_V	1.419	1.00
31_D	35_E	1.387	1.00
34_L	38_Q	1.372	1.00
117_Y	121_F	1.366	1.00
82_N	85_Q	1.306	1.00
19_E	23_E	1.304	1.00
10_E	54_K	1.301	1.00
51_I	65_L	1.300	1.00
107_R	113_K	1.241	1.00
81_L	117_Y	1.239	1.00
24_M	28_K	1.231	1.00
100_E	107_R	1.217	1.00
8_L	71_L	1.214	1.00
56_E	59_E	1.205	1.00
8_L	47_L	1.199	1.00
51_I	55_L	1.199	1.00
7_L	10_E	1.186	1.00
14_E	50_R	1.165	1.00
53_E	56_E	1.160	1.00
12_L	37_L	1.115	1.00
32_A	36_A	1.107	1.00
36_A	40_V	1.101	1.00
54_K	57_E	1.094	1.00
21_I	36_A	1.092	1.00
36_A	39_G	1.069	1.00
28_K	39_G	1.064	1.00
2_I	7_L	1.053	1.00
78_H	82_N	1.051	1.00
20_K	23_E	1.046	1.00
3_N	66_T	1.044	1.00
47_L	50_R	1.040	1.00
28_K	36_A	1.021	1.00
24_M	27_E	1.008	1.00
16_G	20_K	0.999	1.00
30_K	33_L	0.990	1.00
35_E	38_Q	0.972	1.00
16_G	19_E	0.970	1.00
68_V	77_S	0.970	1.00
53_E	57_E	0.962	1.00
12_L	15_R	0.959	1.00
21_I	25_E	0.958	1.00
20_K	32_A	0.944	1.00
20_K	28_K	0.934	1.00
117_Y	120_A	0.927	1.00
7_L	50_R	0.927	1.00
15_R	40_V	0.925	1.00
65_L	93_T	0.921	1.00
113_K	116_N	0.918	1.00
30_K	74_F	0.905	1.00
45_D	83_N	0.895	1.00
63_V	88_V	0.890	1.00
13_E	19_E	0.885	0.99
71_L	74_F	0.884	0.99
49_P	52_A	0.884	0.99
23_E	27_E	0.879	0.99
24_M	36_A	0.873	0.99
103_G	109_F	0.872	0.99
19_E	22_L	0.856	0.99
17_L	21_I	0.855	0.99
80_L	114_D	0.837	0.99
48_A	87_V	0.836	0.99
20_K	24_M	0.823	0.99
88_V	93_T	0.821	0.99
104_Q	107_R	0.818	0.99
47_L	51_I	0.818	0.99
68_V	78_H	0.815	0.99
33_L	36_A	0.814	0.99
111_K	115_D	0.807	0.99
29_G	32_A	0.795	0.99
32_A	35_E	0.794	0.99
17_L	40_V	0.783	0.99
15_R	46_K	0.772	0.99
92_P	97_Y	0.753	0.98
28_K	32_A	0.752	0.98
55_L	58_D	0.734	0.98
62_V	96_F	0.727	0.98
12_L	17_L	0.724	0.98
92_P	106_L	0.723	0.98
112_L	115_D	0.720	0.98
52_A	55_L	0.719	0.98
58_D	61_D	0.717	0.98
39_G	43_P	0.716	0.98
46_K	55_L	0.714	0.98
48_A	58_D	0.713	0.98
102_D	114_D	0.713	0.98
46_K	50_R	0.712	0.98
23_E	26_K	0.710	0.98
112_L	116_N	0.703	0.97
47_L	52_A	0.698	0.97
74_F	85_Q	0.695	0.97
55_L	60_R	0.692	0.97
3_N	67_G	0.692	0.97
79_T	86_G	0.688	0.97
12_L	21_I	0.682	0.97
60_R	63_V	0.680	0.97
39_G	42_D	0.675	0.97
69_G	81_L	0.673	0.97
63_V	91_V	0.666	0.96
68_V	108_L	0.664	0.96
101_Y	108_L	0.662	0.96
109_F	112_L	0.662	0.96
6_D	70_A	0.662	0.96
45_D	49_P	0.658	0.96
18_L	21_I	0.650	0.96
6_D	9_I	0.649	0.96
67_G	72_F	0.649	0.96
105_S	114_D	0.647	0.96
19_E	27_E	0.639	0.95
46_K	58_D	0.632	0.95
24_M	40_V	0.626	0.95
21_I	28_K	0.619	0.95
8_L	41_L	0.618	0.95
116_N	119_R	0.614	0.94
16_G	29_G	0.609	0.94
77_S	82_N	0.608	0.94
17_L	24_M	0.607	0.94
21_I	24_M	0.600	0.94
9_I	21_I	0.599	0.94
47_L	84_L	0.598	0.94
42_D	45_D	0.597	0.94
21_I	33_L	0.594	0.93
49_P	87_V	0.594	0.93
65_L	85_Q	0.591	0.93
12_L	97_Y	0.590	0.93
51_I	84_L	0.589	0.93
11_I	40_V	0.582	0.93
28_K	31_D	0.581	0.93
100_E	113_K	0.579	0.92
63_V	67_G	0.574	0.92
83_N	86_G	0.573	0.92
17_L	36_A	0.572	0.92
26_K	29_G	0.571	0.92
105_S	109_F	0.569	0.92
91_V	107_R	0.567	0.92
79_T	83_N	0.563	0.91
6_D	54_K	0.559	0.91
5_Y	70_A	0.559	0.91
23_E	90_D	0.550	0.90
106_L	110_G	0.546	0.90
48_A	52_A	0.530	0.89
43_P	49_P	0.529	0.89
70_A	86_G	0.525	0.88
55_L	88_V	0.524	0.88
69_G	72_F	0.521	0.88
43_P	79_T	0.520	0.88
49_P	122_N	0.519	0.88
53_E	58_D	0.519	0.88
77_S	80_L	0.519	0.88
52_A	88_V	0.515	0.87
97_Y	101_Y	0.514	0.87
105_S	113_K	0.513	0.87
15_R	21_I	0.509	0.87
32_A	39_G	0.504	0.86
8_L	11_I	0.500	0.86

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2hekA	4	0.8455	13.5	0.912	Contact Map
3cmuA	1	0.9512	10.7	0.916	Contact Map
1oaoC	1	0.6341	8.3	0.92	Contact Map
3zh9B	1	0.9431	7.4	0.922	Contact Map
1sazA	3	0.9268	6.1	0.925	Contact Map
1moqA	2	0.9431	5.2	0.928	Contact Map
4s1wA	2	0.8374	5	0.928	Contact Map
3hn7A	1	0.6748	4.9	0.928	Contact Map
1vmkA	3	0.5854	4.4	0.93	Contact Map
2hlsA	5	0.8537	4.3	0.93	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.