Nse4_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Nse4_C - Nse4 C-terminal

PFAM:	PF08743	Sequences: PINLFEFVINPNSFAQTVENIFYLSFLVRDGRAGIELDEDGLPVIEPVNPPEAEEAASGGVARNQAVFSLDMKDWKELIEAFEITEPMIPH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	91 (89)
Sequences:	795 (629)
Seq/√Len:	66.6
META:	0.267

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
10_N	16_Q	5.466	1.00
71_D	74_D	4.860	1.00
17_T	70_L	3.765	1.00
8_V	21_I	3.672	1.00
8_V	24_L	3.353	1.00
4_L	21_I	3.267	1.00
24_L	45_I	3.056	1.00
7_F	45_I	2.451	1.00
3_N	6_E	2.138	1.00
79_I	84_I	1.827	1.00
4_L	68_F	1.826	1.00
77_E	81_A	1.809	1.00
4_L	8_V	1.749	1.00
14_F	25_S	1.680	0.99
9_I	78_L	1.610	0.99
76_K	79_I	1.512	0.99
84_I	89_I	1.439	0.98
9_I	17_T	1.434	0.98
68_F	72_M	1.323	0.97
85_T	89_I	1.320	0.97
56_A	61_V	1.316	0.97
24_L	33_A	1.315	0.97
17_T	20_N	1.303	0.97
31_G	75_W	1.265	0.96
65_Q	72_M	1.245	0.96
14_F	18_V	1.237	0.96
11_P	23_Y	1.181	0.94
13_S	33_A	1.180	0.94
19_E	22_F	1.166	0.94
46_E	70_L	1.163	0.94
87_P	90_P	1.156	0.94
72_M	76_K	1.142	0.93
17_T	74_D	1.138	0.93
10_N	19_E	1.128	0.93
26_F	65_Q	1.073	0.91
18_V	70_L	1.066	0.91
7_F	89_I	1.046	0.90
19_E	23_Y	0.994	0.87
13_S	35_I	0.979	0.86
12_N	15_A	0.974	0.86
4_L	15_A	0.918	0.83
51_P	55_E	0.914	0.82
27_L	31_G	0.910	0.82
16_Q	22_F	0.906	0.82
28_V	65_Q	0.905	0.82
70_L	78_L	0.900	0.81
11_P	79_I	0.868	0.79
41_G	75_W	0.867	0.79
51_P	61_V	0.856	0.78
51_P	56_A	0.853	0.78
76_K	80_E	0.850	0.77
5_F	11_P	0.844	0.77
50_P	90_P	0.830	0.76
16_Q	19_E	0.826	0.75
11_P	82_F	0.808	0.74
51_P	71_D	0.806	0.74
67_V	90_P	0.804	0.73
25_S	35_I	0.773	0.70
55_E	59_G	0.771	0.70
46_E	68_F	0.754	0.69
47_P	50_P	0.747	0.68
16_Q	23_Y	0.746	0.68
15_A	66_A	0.744	0.67
2_I	88_M	0.740	0.67
29_R	65_Q	0.734	0.66
28_V	68_F	0.729	0.66
39_E	56_A	0.725	0.65
53_A	56_A	0.721	0.65
73_K	77_E	0.718	0.65
36_E	62_A	0.717	0.65
15_A	23_Y	0.706	0.63
21_I	62_A	0.703	0.63
82_F	87_P	0.701	0.63
78_L	81_A	0.672	0.60
20_N	26_F	0.671	0.60
51_P	58_S	0.671	0.60
37_L	40_D	0.661	0.58
75_W	78_L	0.657	0.58
28_V	62_A	0.656	0.58
52_E	60_G	0.655	0.58
4_L	23_Y	0.652	0.57
8_V	42_L	0.646	0.57
22_F	26_F	0.638	0.56
39_E	57_A	0.637	0.56
7_F	82_F	0.637	0.56
67_V	81_A	0.630	0.55
16_Q	90_P	0.630	0.55
23_Y	68_F	0.630	0.55
12_N	50_P	0.626	0.54
28_V	48_V	0.625	0.54
83_E	86_E	0.621	0.54
34_G	57_A	0.605	0.52
37_L	78_L	0.601	0.51
17_T	23_Y	0.600	0.51
60_G	64_N	0.593	0.50
36_E	44_V	0.590	0.50
34_G	73_K	0.588	0.50
22_F	29_R	0.586	0.50
41_G	60_G	0.582	0.49
16_Q	25_S	0.581	0.49
62_A	70_L	0.578	0.49
41_G	49_N	0.577	0.48
31_G	47_P	0.576	0.48
17_T	63_R	0.563	0.47
2_I	41_G	0.563	0.47
70_L	74_D	0.558	0.46
32_R	80_E	0.554	0.46
18_V	35_I	0.551	0.45
12_N	62_A	0.548	0.45
53_A	73_K	0.547	0.45
3_N	70_L	0.544	0.45
3_N	44_V	0.543	0.44
32_R	56_A	0.534	0.43
36_E	46_E	0.533	0.43
53_A	57_A	0.528	0.43
13_S	70_L	0.527	0.43
10_N	75_W	0.527	0.43
44_V	81_A	0.526	0.43
8_V	23_Y	0.522	0.42
48_V	51_P	0.521	0.42
21_I	25_S	0.521	0.42
43_P	76_K	0.520	0.42
57_A	68_F	0.519	0.42
15_A	21_I	0.511	0.41
16_Q	28_V	0.510	0.41
11_P	84_I	0.508	0.40
45_I	60_G	0.506	0.40
47_P	54_E	0.506	0.40
5_F	36_E	0.506	0.40
17_T	78_L	0.506	0.40
48_V	52_E	0.504	0.40
40_D	63_R	0.503	0.40
23_Y	65_Q	0.501	0.40
11_P	87_P	0.500	0.40

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3buaE	1	0.033	11.8	0.908	Contact Map
1ichA	1	0.3516	5.9	0.92	Contact Map
2g8yA	2	0.9121	5.6	0.921	Contact Map
2a8jA	2	0.4725	5	0.923	Contact Map
1zceA	1	0.7363	4.4	0.925	Contact Map
4i99C	1	0.5275	4.1	0.926	Contact Map
3oq9A	3	0.3407	4	0.926	Contact Map
3uw1A	2	0.7473	3.8	0.927	Contact Map
1vbiA	2	0.8791	3.4	0.928	Contact Map
1nxuA	2	0.8132	3.3	0.929	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.