C8 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

C8 - C8 domain

PFAM:	PF08742	Sequences: AEELCGILLSPNGPFAACHSVVDPEPYYEACVYDLCACGGGDDCLCSALAAYARACAAAGVCVDWRTPTFC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	71 (70)
Sequences:	4727 (2934)
Seq/√Len:	350.7
META:	0.125

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
38_C	44_C	3.981	1.00
9_L	28_Y	3.174	1.00
18_C	56_C	3.051	1.00
15_F	53_A	2.839	1.00
19_H	52_Y	2.503	1.00
24_P	52_Y	2.380	1.00
28_Y	32_V	2.067	1.00
67_T	70_F	1.968	1.00
7_I	49_L	1.868	1.00
50_A	54_R	1.737	1.00
19_H	24_P	1.687	1.00
35_L	45_L	1.656	1.00
30_A	33_Y	1.565	1.00
25_E	29_E	1.564	1.00
27_Y	55_A	1.490	1.00
21_V	61_V	1.395	1.00
22_V	55_A	1.377	1.00
55_A	58_A	1.319	1.00
10_S	13_G	1.275	1.00
54_R	58_A	1.259	1.00
50_A	66_R	1.235	1.00
15_F	19_H	1.182	1.00
55_A	59_A	1.170	1.00
11_P	16_A	1.127	1.00
46_C	71_C	1.121	1.00
51_A	55_A	1.080	1.00
22_V	59_A	1.077	1.00
54_R	57_A	1.072	1.00
10_S	14_P	1.071	1.00
5_C	31_C	1.057	1.00
13_G	19_H	1.048	1.00
4_L	35_L	1.047	1.00
49_L	63_V	1.045	1.00
8_L	19_H	1.003	1.00
45_L	70_F	1.002	1.00
37_A	47_S	0.995	1.00
13_G	16_A	0.992	1.00
53_A	65_W	0.980	1.00
52_Y	61_V	0.976	1.00
57_A	62_C	0.950	1.00
21_V	59_A	0.936	1.00
38_C	41_G	0.899	1.00
26_P	30_A	0.895	1.00
22_V	61_V	0.894	1.00
53_A	63_V	0.889	1.00
31_C	36_C	0.888	1.00
30_A	34_D	0.884	1.00
4_L	45_L	0.864	1.00
44_C	47_S	0.861	1.00
51_A	54_R	0.860	1.00
2_E	32_V	0.848	1.00
40_G	43_D	0.838	1.00
42_D	68_P	0.837	1.00
30_A	51_A	0.836	1.00
64_D	70_F	0.834	1.00
9_L	24_P	0.793	1.00
29_E	32_V	0.762	1.00
6_G	9_L	0.747	1.00
35_L	47_S	0.746	1.00
66_R	70_F	0.746	1.00
15_F	49_L	0.736	1.00
31_C	34_D	0.733	1.00
41_G	44_C	0.719	0.99
64_D	67_T	0.701	0.99
47_S	57_A	0.694	0.99
8_L	28_Y	0.684	0.99
37_A	51_A	0.670	0.99
2_E	10_S	0.659	0.99
5_C	18_C	0.658	0.99
53_A	57_A	0.640	0.99
37_A	44_C	0.639	0.99
24_P	27_Y	0.633	0.99
19_H	22_V	0.627	0.98
33_Y	37_A	0.626	0.98
4_L	40_G	0.624	0.98
45_L	49_L	0.620	0.98
22_V	43_D	0.619	0.98
22_V	52_Y	0.610	0.98
44_C	48_A	0.609	0.98
19_H	28_Y	0.605	0.98
37_A	41_G	0.599	0.98
17_A	61_V	0.587	0.98
30_A	48_A	0.583	0.98
26_P	41_G	0.580	0.97
32_V	35_L	0.574	0.97
8_L	13_G	0.573	0.97
50_A	69_T	0.570	0.97
35_L	43_D	0.567	0.97
34_D	48_A	0.561	0.97
2_E	64_D	0.559	0.97
32_V	45_L	0.551	0.97
64_D	68_P	0.545	0.96
10_S	19_H	0.542	0.96
49_L	70_F	0.538	0.96
10_S	16_A	0.536	0.96
39_G	47_S	0.535	0.96
27_Y	52_Y	0.531	0.96
48_A	52_Y	0.530	0.96
28_Y	35_L	0.526	0.96
33_Y	45_L	0.518	0.95
9_L	25_E	0.517	0.95
42_D	45_L	0.517	0.95
3_E	21_V	0.510	0.95
7_I	68_P	0.504	0.94
3_E	6_G	0.500	0.94

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4bq6D	1	0	6	0.868	Contact Map
2lpyA	1	0.4507	2.1	0.895	Contact Map
3c8xA	2	0.3944	1.6	0.902	Contact Map
1baxA	1	0.4648	1.4	0.905	Contact Map
2munA	1	0.6338	1	0.915	Contact Map
4zrlB	1	0.7183	0.9	0.915	Contact Map
4fvmA	1	0.0986	0.9	0.915	Contact Map
3u3lC	1	0.5775	0.9	0.915	Contact Map
3ghmA	1	0.8169	0.9	0.917	Contact Map
2qyuA	1	0.6479	0.9	0.917	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0042 seconds.