D5_N - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

D5_N - D5 N terminal like

PFAM:	PF08706	Sequences: AERFADLYGDDLRYVPEWGKWYVWDGTRWEEDDTGAVRRLAKEVARAIAEEAEEDEKKRKALLKWAKKSESASRIKAMLKLARSDPLAVTPDELDADPWLLNVPNGTLDLRTGELRPHRPEDYITKITPVDYDPDADCPRWEKFLDEIFP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	150 (147)
Sequences:	18069 (16010)
Seq/√Len:	1320.5
META:	0.93

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
76_K	80_K	3.325	1.00
72_A	76_K	3.070	1.00
72_A	80_K	3.041	1.00
116_R	122_D	2.963	1.00
106_G	115_L	2.959	1.00
107_T	122_D	2.719	1.00
99_W	111_R	2.618	1.00
104_P	131_D	2.574	1.00
101_L	128_T	2.488	1.00
75_I	81_L	2.400	1.00
143_K	147_E	2.261	1.00
102_N	124_I	2.199	1.00
20_K	31_E	2.000	1.00
72_A	81_L	1.993	1.00
65_W	69_S	1.978	1.00
11_D	120_P	1.912	1.00
27_T	127_I	1.787	1.00
102_N	118_H	1.740	1.00
138_C	142_E	1.729	1.00
144_F	148_I	1.708	1.00
73_S	77_A	1.696	1.00
107_T	124_I	1.689	1.00
25_D	28_R	1.666	1.00
108_L	113_G	1.665	1.00
103_V	108_L	1.624	1.00
71_S	74_R	1.621	1.00
25_D	30_E	1.618	1.00
42_K	85_D	1.604	1.00
18_W	22_Y	1.597	1.00
109_D	116_R	1.595	1.00
105_N	131_D	1.584	1.00
15_V	18_W	1.508	1.00
93_E	123_Y	1.502	1.00
104_P	127_I	1.472	1.00
97_D	100_L	1.466	1.00
109_D	112_T	1.394	1.00
140_R	147_E	1.392	1.00
104_P	129_P	1.392	1.00
5_A	87_L	1.381	1.00
68_K	74_R	1.373	1.00
13_R	123_Y	1.371	1.00
17_E	91_P	1.356	1.00
89_V	94_L	1.342	1.00
100_L	124_I	1.322	1.00
80_K	83_R	1.306	1.00
100_L	116_R	1.252	1.00
72_A	77_A	1.249	1.00
142_E	146_D	1.239	1.00
140_R	143_K	1.237	1.00
36_A	40_L	1.234	1.00
137_D	142_E	1.234	1.00
102_N	127_I	1.214	1.00
27_T	118_H	1.213	1.00
28_R	127_I	1.194	1.00
17_E	33_D	1.189	1.00
103_V	130_V	1.180	1.00
103_V	128_T	1.162	1.00
22_Y	31_E	1.135	1.00
89_V	123_Y	1.126	1.00
95_D	125_T	1.121	1.00
13_R	89_V	1.108	1.00
89_V	93_E	1.103	1.00
141_W	144_F	1.094	1.00
41_A	45_A	1.075	1.00
119_R	122_D	1.074	1.00
140_R	144_F	1.064	1.00
68_K	71_S	1.060	1.00
15_V	22_Y	1.056	1.00
34_T	38_R	1.037	1.00
146_D	149_F	1.036	1.00
7_L	47_A	1.030	1.00
71_S	77_A	1.022	1.00
90_T	93_E	0.999	1.00
48_I	51_E	0.994	1.00
41_A	44_V	0.992	1.00
100_L	107_T	0.987	1.00
35_G	38_R	0.985	1.00
23_V	32_D	0.983	1.00
18_W	91_P	0.983	1.00
18_W	31_E	0.983	1.00
22_Y	94_L	0.981	1.00
74_R	77_A	0.980	1.00
41_A	78_M	0.953	1.00
55_D	59_R	0.948	1.00
4_F	82_A	0.948	1.00
133_D	136_A	0.940	1.00
37_V	41_A	0.940	1.00
60_K	64_K	0.930	1.00
118_H	127_I	0.928	1.00
57_K	61_A	0.920	1.00
36_A	39_R	0.915	1.00
56_E	59_R	0.887	1.00
100_L	109_D	0.886	1.00
64_K	67_K	0.885	1.00
74_R	78_M	0.882	1.00
11_D	23_V	0.881	1.00
81_L	85_D	0.870	1.00
100_L	122_D	0.870	1.00
97_D	122_D	0.865	1.00
79_L	83_R	0.849	1.00
141_W	145_L	0.849	1.00
77_A	81_L	0.847	1.00
39_R	42_K	0.846	1.00
107_T	118_H	0.845	1.00
144_F	147_E	0.845	1.00
138_C	141_W	0.841	1.00
105_N	115_L	0.840	1.00
17_E	90_T	0.834	1.00
4_F	12_L	0.830	1.00
24_W	120_P	0.818	1.00
102_N	107_T	0.814	1.00
27_T	104_P	0.811	1.00
40_L	45_A	0.808	1.00
12_L	23_V	0.807	1.00
105_N	132_Y	0.802	1.00
99_W	109_D	0.802	1.00
49_A	52_A	0.800	1.00
104_P	128_T	0.789	1.00
94_L	125_T	0.783	1.00
33_D	90_T	0.780	1.00
55_D	58_K	0.778	1.00
46_R	49_A	0.771	1.00
35_G	39_R	0.757	1.00
95_D	126_K	0.747	1.00
108_L	115_L	0.744	1.00
40_L	44_V	0.742	1.00
34_T	37_V	0.734	1.00
65_W	68_K	0.731	1.00
24_W	28_R	0.731	1.00
15_V	91_P	0.731	1.00
90_T	94_L	0.729	1.00
47_A	51_E	0.722	1.00
24_W	27_T	0.714	1.00
69_S	78_M	0.713	1.00
101_L	110_L	0.707	1.00
37_V	44_V	0.699	1.00
61_A	64_K	0.696	1.00
56_E	60_K	0.693	1.00
38_R	84_S	0.693	1.00
128_T	131_D	0.689	1.00
36_A	41_A	0.689	1.00
5_A	9_G	0.686	1.00
37_V	40_L	0.676	1.00
38_R	76_K	0.675	1.00
63_L	67_K	0.673	1.00
4_F	8_Y	0.670	1.00
62_L	65_W	0.670	1.00
103_V	106_G	0.669	1.00
109_D	114_E	0.668	1.00
97_D	111_R	0.666	1.00
64_K	68_K	0.661	1.00
19_G	83_R	0.659	1.00
8_Y	11_D	0.657	1.00
11_D	40_L	0.654	1.00
69_S	74_R	0.653	1.00
14_Y	83_R	0.647	1.00
94_L	123_Y	0.646	1.00
38_R	42_K	0.646	1.00
42_K	45_A	0.645	1.00
75_I	84_S	0.641	1.00
5_A	85_D	0.639	1.00
12_L	40_L	0.637	1.00
23_V	36_A	0.634	1.00
53_E	58_K	0.634	1.00
47_A	50_E	0.632	1.00
73_S	76_K	0.631	1.00
21_W	82_A	0.629	1.00
4_F	78_M	0.629	1.00
16_P	35_G	0.628	1.00
16_P	88_A	0.628	1.00
45_A	49_A	0.626	1.00
53_E	59_R	0.621	1.00
102_N	126_K	0.617	1.00
107_T	116_R	0.607	1.00
65_W	74_R	0.604	1.00
44_V	47_A	0.600	1.00
10_D	120_P	0.598	1.00
39_R	43_E	0.597	1.00
81_L	84_S	0.594	1.00
38_R	75_I	0.590	1.00
16_P	19_G	0.589	1.00
115_L	132_Y	0.587	1.00
93_E	96_A	0.584	1.00
145_L	149_F	0.582	1.00
45_A	48_I	0.579	1.00
101_L	108_L	0.576	1.00
77_A	80_K	0.565	1.00
35_G	83_R	0.562	1.00
22_Y	125_T	0.562	1.00
12_L	87_L	0.557	1.00
76_K	83_R	0.557	1.00
57_K	60_K	0.557	1.00
143_K	146_D	0.555	1.00
103_V	131_D	0.554	1.00
15_V	89_V	0.550	1.00
49_A	63_L	0.548	1.00
103_V	115_L	0.541	1.00
39_R	86_P	0.539	1.00
39_R	85_D	0.537	1.00
70_E	74_R	0.536	1.00
53_E	57_K	0.536	1.00
38_R	41_A	0.536	1.00
3_R	51_E	0.533	1.00
66_A	70_E	0.530	1.00
104_P	130_V	0.525	1.00
116_R	119_R	0.523	1.00
97_D	124_I	0.522	1.00
34_T	41_A	0.520	1.00
59_R	63_L	0.519	1.00
67_K	70_E	0.516	1.00
107_T	119_R	0.516	1.00
54_E	58_K	0.514	1.00
60_K	63_L	0.512	1.00
15_V	94_L	0.511	1.00
40_L	43_E	0.509	1.00
13_R	87_L	0.508	1.00
8_Y	12_L	0.506	1.00
75_I	78_M	0.506	1.00
132_Y	136_A	0.504	1.00
75_I	79_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2wujA	2	0.2133	4.6	0.924	Contact Map
1xatA	3	0.3533	3.9	0.927	Contact Map
4hurA	3	0.3467	3.3	0.93	Contact Map
3n2qA	2	0.4333	3.2	0.93	Contact Map
3ihpA	1	0.3333	2.7	0.933	Contact Map
2fa8A	3	0.22	2.6	0.933	Contact Map
3juiA	1	0.3333	2.5	0.934	Contact Map
3eevA	3	0.3533	2.1	0.936	Contact Map
1paqA	1	0.3267	2	0.937	Contact Map
4ro3A	2	0.3933	1.9	0.938	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.