GN3L_Grn1 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

GN3L_Grn1 - GNL3L/Grn1 putative GTPase

PFAM:	PF08701	Sequences: RLRYKIEKKVREHHRKLRKEAKKNPKWKSKKKKDPGIPNLFPFKEELLKEIEEKKERKEEEKERRKEARKAERAK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	75 (74)
Sequences:	805 (597)
Seq/√Len:	69.4
META:	0.472

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
12_E	15_R	2.651	1.00
25_P	28_K	2.370	1.00
13_H	17_L	2.232	1.00
4_Y	7_E	2.138	1.00
61_E	65_R	2.072	1.00
45_E	49_K	2.055	1.00
41_F	47_L	1.938	1.00
68_A	72_E	1.898	1.00
10_V	13_H	1.889	1.00
64_R	68_A	1.845	1.00
39_N	44_K	1.812	1.00
56_E	60_E	1.807	1.00
63_E	67_E	1.797	1.00
20_E	23_K	1.646	0.99
40_L	50_E	1.606	0.99
31_K	40_L	1.506	0.99
54_K	57_R	1.461	0.99
53_E	56_E	1.430	0.98
64_R	67_E	1.423	0.98
10_V	14_H	1.389	0.98
5_K	9_K	1.368	0.98
51_I	54_K	1.364	0.98
47_L	50_E	1.355	0.98
18_R	21_A	1.338	0.98
19_K	23_K	1.283	0.97
71_A	74_A	1.263	0.96
61_E	64_R	1.245	0.96
60_E	64_R	1.234	0.96
20_E	24_N	1.233	0.96
37_I	47_L	1.216	0.96
7_E	11_R	1.215	0.96
2_L	6_I	1.200	0.95
20_E	28_K	1.146	0.94
59_E	63_E	1.136	0.94
68_A	71_A	1.106	0.93
33_K	36_G	1.061	0.91
9_K	13_H	1.049	0.91
11_R	18_R	1.048	0.91
9_K	12_E	1.045	0.91
15_R	18_R	1.003	0.89
1_R	4_Y	0.996	0.88
55_K	61_E	0.969	0.87
67_E	71_A	0.958	0.86
40_L	46_E	0.952	0.86
39_N	48_L	0.934	0.85
66_K	69_R	0.910	0.83
5_K	12_E	0.895	0.82
6_I	10_V	0.894	0.82
56_E	59_E	0.885	0.82
53_E	57_R	0.880	0.81
6_I	13_H	0.872	0.81
67_E	70_K	0.870	0.80
22_K	30_K	0.870	0.80
17_L	20_E	0.870	0.80
70_K	73_R	0.865	0.80
1_R	19_K	0.857	0.79
65_R	68_A	0.853	0.79
52_E	56_E	0.846	0.79
2_L	5_K	0.845	0.79
65_R	69_R	0.800	0.75
32_K	40_L	0.796	0.74
58_K	62_K	0.795	0.74
58_K	61_E	0.794	0.74
68_A	73_R	0.783	0.73
3_R	41_F	0.762	0.71
69_R	73_R	0.756	0.70
59_E	71_A	0.753	0.70
57_R	60_E	0.751	0.70
41_F	51_I	0.750	0.70
3_R	7_E	0.719	0.67
8_K	15_R	0.703	0.65
46_E	51_I	0.696	0.64
69_R	72_E	0.695	0.64
49_K	54_K	0.693	0.64
19_K	39_N	0.674	0.62
39_N	59_E	0.667	0.61
59_E	62_K	0.662	0.60
37_I	41_F	0.651	0.59
3_R	37_I	0.642	0.58
24_N	28_K	0.641	0.58
4_Y	13_H	0.640	0.58
45_E	68_A	0.635	0.57
3_R	69_R	0.634	0.57
65_R	72_E	0.621	0.55
31_K	50_E	0.620	0.55
40_L	47_L	0.615	0.55
4_Y	11_R	0.612	0.54
68_A	74_A	0.611	0.54
46_E	49_K	0.607	0.54
14_H	52_E	0.604	0.53
7_E	18_R	0.604	0.53
8_K	32_K	0.600	0.53
23_K	28_K	0.597	0.52
8_K	71_A	0.591	0.52
55_K	59_E	0.586	0.51
3_R	51_I	0.583	0.51
16_K	47_L	0.581	0.50
18_R	52_E	0.573	0.50
65_R	73_R	0.570	0.49
5_K	51_I	0.568	0.49
22_K	70_K	0.564	0.48
26_K	30_K	0.556	0.47
28_K	31_K	0.554	0.47
21_A	24_N	0.543	0.46
15_R	42_P	0.543	0.46
2_L	13_H	0.536	0.45
48_L	51_I	0.531	0.44
15_R	35_P	0.528	0.44
11_R	51_I	0.512	0.42
22_K	25_P	0.504	0.41
46_E	53_E	0.500	0.41

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2i1jA	3	0.3333	9.5	0.878	Contact Map
3j7yq	1	0.9733	4.9	0.893	Contact Map
1v8kA	3	0	2.6	0.907	Contact Map
1ef1C	1	0.3333	2.5	0.908	Contact Map
1utyA	2	0.1867	2.4	0.909	Contact Map
4zrjB	1	0.32	1.9	0.913	Contact Map
3fcnA	2	0.7867	1.9	0.914	Contact Map
4yhuA	1	0	1.4	0.919	Contact Map
3fyfA	2	0.3467	1.2	0.923	Contact Map
4mh6A	1	0.5333	1	0.927	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.