DUF1762 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1762 - Protein of unknown function (DUF1762)

PFAM:	PF08574	Sequences: DDDDYVYDVYYREPDAADTSEDAPPGNIGVLVIDEEDEELWEEFYEDDDDSDEEEDEDDEDSNAENNYRNDYPDEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	76 (73)
Sequences:	584 (472)
Seq/√Len:	55.2
META:	0.296

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
29_G	32_V	2.824	1.00
62_S	70_N	2.573	1.00
7_Y	10_Y	2.294	1.00
64_A	69_R	2.290	1.00
12_R	76_E	2.152	1.00
7_Y	62_S	1.941	1.00
59_D	62_S	1.860	0.99
8_D	13_E	1.779	0.99
56_D	59_D	1.710	0.99
3_D	75_E	1.638	0.99
71_D	76_E	1.569	0.98
55_E	58_D	1.538	0.98
12_R	74_D	1.499	0.97
26_G	31_L	1.399	0.96
29_G	68_Y	1.367	0.96
8_D	57_E	1.351	0.95
65_E	72_Y	1.347	0.95
65_E	73_P	1.347	0.95
12_R	59_D	1.306	0.94
52_D	55_E	1.286	0.94
60_E	69_R	1.276	0.94
38_E	41_W	1.272	0.94
23_A	27_N	1.244	0.93
37_D	40_L	1.217	0.92
10_Y	13_E	1.205	0.92
60_E	67_N	1.199	0.91
12_R	29_G	1.163	0.90
29_G	33_I	1.152	0.90
19_T	22_D	1.148	0.89
37_D	41_W	1.145	0.89
16_A	19_T	1.117	0.88
18_D	24_P	1.104	0.88
15_D	18_D	1.097	0.87
13_E	16_A	1.092	0.87
41_W	45_Y	1.090	0.87
15_D	24_P	1.085	0.87
21_E	24_P	1.085	0.87
7_Y	70_N	1.084	0.87
57_E	68_Y	1.079	0.86
71_D	75_E	1.071	0.86
23_A	26_G	1.065	0.86
2_D	22_D	1.032	0.84
53_E	56_D	1.025	0.83
8_D	34_D	1.013	0.83
16_A	20_S	1.005	0.82
21_E	25_P	1.000	0.82
19_T	25_P	0.976	0.80
3_D	11_Y	0.974	0.80
55_E	64_A	0.952	0.79
65_E	71_D	0.951	0.78
4_D	46_E	0.928	0.77
20_S	25_P	0.913	0.76
33_I	41_W	0.908	0.75
67_N	70_N	0.889	0.74
17_A	20_S	0.883	0.73
33_I	38_E	0.877	0.73
37_D	64_A	0.876	0.72
33_I	36_E	0.867	0.72
60_E	68_Y	0.857	0.71
64_A	72_Y	0.839	0.69
64_A	73_P	0.839	0.69
46_E	51_S	0.827	0.68
9_V	62_S	0.821	0.68
40_L	76_E	0.804	0.66
46_E	50_D	0.794	0.65
22_D	34_D	0.785	0.64
73_P	76_E	0.774	0.63
72_Y	76_E	0.774	0.63
4_D	51_S	0.773	0.63
64_A	68_Y	0.760	0.61
5_Y	9_V	0.757	0.61
10_Y	58_D	0.749	0.60
43_E	46_E	0.744	0.60
63_N	73_P	0.741	0.60
63_N	72_Y	0.741	0.60
48_D	54_E	0.736	0.59
17_A	21_E	0.708	0.56
65_E	70_N	0.702	0.55
70_N	73_P	0.689	0.54
33_I	40_L	0.687	0.54
27_N	31_L	0.687	0.54
43_E	74_D	0.684	0.54
2_D	47_D	0.679	0.53
10_Y	66_N	0.674	0.52
19_T	52_D	0.674	0.52
18_D	23_A	0.661	0.51
8_D	43_E	0.655	0.50
66_N	69_R	0.652	0.50
44_F	48_D	0.651	0.50
24_P	27_N	0.644	0.49
24_P	28_I	0.643	0.49
13_E	58_D	0.640	0.49
9_V	60_E	0.631	0.48
49_D	52_D	0.629	0.48
25_P	39_E	0.616	0.46
17_A	22_D	0.601	0.45
43_E	51_S	0.594	0.44
4_D	49_D	0.586	0.43
18_D	22_D	0.551	0.39
17_A	26_G	0.541	0.38
51_S	54_E	0.540	0.38
21_E	40_L	0.538	0.38
8_D	20_S	0.534	0.38
20_S	23_A	0.534	0.38
41_W	56_D	0.533	0.38
43_E	62_S	0.533	0.38
36_E	46_E	0.530	0.37
62_S	68_Y	0.527	0.37
6_V	9_V	0.511	0.35
60_E	64_A	0.500	0.34

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4kblA	2	0	2.4	0.896	Contact Map
1dq3A	1	0.3684	2.4	0.896	Contact Map
2cw8A	1	0.3684	1.7	0.905	Contact Map
2imzA	2	0.3289	1	0.916	Contact Map
4cayC	1	0.0921	0.8	0.921	Contact Map
3mwyW	2	0.0263	0.7	0.926	Contact Map
4qvrA	1	0	0.5	0.931	Contact Map
3e6uA	1	0.3158	0.5	0.935	Contact Map
2i50A	1	0.3421	0.4	0.936	Contact Map
1am2A	2	0.3553	0.4	0.938	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.