PRP3 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PRP3 - pre-mRNA processing factor 3 (PRP3)

PFAM:	PF08572	Sequences: NPYFDPRLGAKPKRRKRRQLKFNEKGKYIQQAEALRRKAQLEELKKRIAEAARKAGIDEDLDLAEKNPKVPEDEVPPDVEWWDEGLLPGKTYDDIDDEKIDSKDSKITIYVQHPVPIEPPQEKNKPPPKPLYLTKKEQKKLRRQRRMEELKEKQEKIRLGLEPPPPPKVKLSNLMRVLGSEAVQDPTKVEARVRRQMAERQQAHEEANEARKLT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	214 (210)
Sequences:	516 (348)
Seq/√Len:	24.0
META:	0.221

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
192_R	196_Q	4.304	1.00
206_E	210_A	3.848	1.00
92_Y	95_I	3.745	1.00
5_D	8_L	3.468	1.00
23_N	28_Y	3.324	1.00
150_L	153_K	2.946	1.00
156_K	159_L	2.714	0.99
174_L	178_L	2.664	0.99
199_E	203_A	2.540	0.99
201_Q	205_E	2.529	0.99
32_A	36_R	2.471	0.98
135_K	138_Q	2.435	0.98
203_A	207_A	2.396	0.98
151_K	159_L	2.220	0.97
140_K	143_R	2.219	0.97
31_Q	35_L	2.182	0.97
151_K	154_Q	2.111	0.96
142_R	146_R	2.093	0.96
148_E	151_K	2.066	0.95
209_E	212_K	1.975	0.94
179_G	182_A	1.910	0.93
43_E	47_R	1.909	0.93
156_K	162_E	1.900	0.93
170_K	184_Q	1.876	0.92
15_R	18_R	1.726	0.88
122_E	126_P	1.705	0.88
80_E	83_D	1.691	0.87
94_D	97_D	1.663	0.86
205_E	209_E	1.659	0.86
169_V	177_V	1.649	0.86
4_F	8_L	1.645	0.86
89_G	94_D	1.606	0.84
169_V	174_L	1.593	0.84
50_E	54_K	1.573	0.83
145_R	149_E	1.554	0.82
115_V	119_P	1.528	0.81
189_V	193_V	1.525	0.81
17_R	20_L	1.522	0.81
166_P	196_Q	1.517	0.81
155_E	171_L	1.512	0.80
28_Y	32_A	1.502	0.80
170_K	180_S	1.494	0.80
174_L	179_G	1.479	0.79
197_M	201_Q	1.479	0.79
16_K	19_Q	1.462	0.78
86_L	112_Q	1.432	0.77
41_L	48_I	1.413	0.76
154_Q	158_R	1.402	0.75
204_H	211_R	1.378	0.74
140_K	144_Q	1.378	0.74
120_P	126_P	1.363	0.73
23_N	27_K	1.357	0.73
157_I	165_P	1.349	0.72
24_E	179_G	1.347	0.72
94_D	98_E	1.341	0.72
61_L	65_E	1.336	0.71
202_Q	205_E	1.330	0.71
45_K	51_A	1.311	0.70
175_M	183_V	1.310	0.70
153_K	162_E	1.302	0.69
193_V	196_Q	1.301	0.69
145_R	148_E	1.269	0.67
203_A	206_E	1.237	0.65
171_L	197_M	1.228	0.65
60_D	66_K	1.214	0.64
34_A	61_L	1.212	0.64
177_V	187_T	1.204	0.63
6_P	9_G	1.203	0.63
60_D	64_A	1.199	0.63
168_K	172_S	1.176	0.61
51_A	54_K	1.171	0.61
11_K	33_E	1.169	0.61
119_P	122_E	1.156	0.60
59_E	69_K	1.151	0.60
190_E	204_H	1.151	0.60
32_A	187_T	1.144	0.59
200_R	204_H	1.130	0.58
183_V	192_R	1.127	0.58
167_P	190_E	1.122	0.58
180_S	183_V	1.115	0.57
147_M	154_Q	1.111	0.57
92_Y	97_D	1.107	0.57
140_K	145_R	1.104	0.56
45_K	55_A	1.098	0.56
60_D	68_P	1.094	0.56
30_Q	131_L	1.086	0.55
155_E	166_P	1.077	0.54
39_A	191_A	1.075	0.54
176_R	188_K	1.074	0.54
191_A	195_R	1.071	0.54
50_E	53_R	1.064	0.54
156_K	163_P	1.062	0.53
185_D	188_K	1.058	0.53
28_Y	31_Q	1.057	0.53
52_A	55_A	1.055	0.53
175_M	187_T	1.052	0.53
202_Q	210_A	1.050	0.53
178_L	193_V	1.050	0.53
25_K	183_V	1.049	0.53
111_V	145_R	1.047	0.52
48_I	55_A	1.046	0.52
138_Q	187_T	1.032	0.51
154_Q	165_P	1.031	0.51
181_E	205_E	1.028	0.51
143_R	159_L	1.025	0.51
202_Q	206_E	1.025	0.51
141_L	158_R	1.024	0.51
50_E	166_P	1.020	0.50
107_I	181_E	1.018	0.50
48_I	54_K	1.016	0.50
200_R	208_N	1.005	0.49
20_L	192_R	0.999	0.49
166_P	181_E	0.999	0.49
146_R	173_N	0.998	0.49
118_E	123_K	0.996	0.49
19_Q	111_V	0.991	0.48
20_L	155_E	0.989	0.48
36_R	187_T	0.984	0.48
68_P	179_G	0.983	0.48
131_L	143_R	0.974	0.47
42_E	54_K	0.972	0.47
178_L	192_R	0.963	0.46
157_I	176_R	0.949	0.45
163_P	166_P	0.947	0.45
61_L	66_K	0.946	0.45
113_H	135_K	0.941	0.45
13_K	16_K	0.938	0.45
155_E	192_R	0.932	0.44
44_L	48_I	0.924	0.44
134_T	190_E	0.910	0.43
60_D	144_Q	0.907	0.42
123_K	131_L	0.906	0.42
128_P	131_L	0.904	0.42
145_R	162_E	0.892	0.41
29_I	111_V	0.886	0.41
41_L	54_K	0.882	0.41
63_L	172_S	0.879	0.41
38_K	68_P	0.879	0.41
150_L	154_Q	0.877	0.40
44_L	111_V	0.873	0.40
27_K	130_P	0.870	0.40
204_H	208_N	0.869	0.40
34_A	45_K	0.865	0.40
51_A	150_L	0.863	0.39
44_L	55_A	0.857	0.39
162_E	165_P	0.854	0.39
36_R	81_W	0.852	0.39
149_E	172_S	0.851	0.39
182_A	212_K	0.849	0.39
132_Y	143_R	0.849	0.39
130_P	188_K	0.841	0.38
90_K	111_V	0.840	0.38
198_A	202_Q	0.834	0.38
18_R	22_F	0.833	0.37
37_R	40_Q	0.832	0.37
59_E	68_P	0.827	0.37
186_P	208_N	0.826	0.37
165_P	185_D	0.820	0.37
164_P	213_L	0.817	0.36
91_T	95_I	0.814	0.36
46_K	50_E	0.809	0.36
26_G	81_W	0.806	0.36
119_P	210_A	0.803	0.35
166_P	199_E	0.801	0.35
47_R	148_E	0.797	0.35
79_V	124_N	0.795	0.35
38_K	69_K	0.789	0.35
138_Q	196_Q	0.788	0.35
27_K	154_Q	0.787	0.34
22_F	26_G	0.785	0.34
171_L	194_R	0.776	0.34
57_I	61_L	0.773	0.34
184_Q	207_A	0.769	0.33
75_V	192_R	0.766	0.33
20_L	27_K	0.766	0.33
14_R	25_K	0.766	0.33
79_V	90_K	0.766	0.33
36_R	56_G	0.763	0.33
129_K	189_V	0.758	0.33
116_P	141_L	0.753	0.32
16_K	153_K	0.753	0.32
174_L	184_Q	0.752	0.32
118_E	179_G	0.751	0.32
45_K	48_I	0.751	0.32
102_S	111_V	0.751	0.32
86_L	141_L	0.749	0.32
140_K	187_T	0.747	0.32
33_E	37_R	0.743	0.32
164_P	212_K	0.742	0.32
18_R	23_N	0.739	0.31
106_K	156_K	0.737	0.31
167_P	175_M	0.730	0.31
64_A	158_R	0.729	0.31
118_E	121_Q	0.729	0.31
66_K	69_K	0.726	0.31
69_K	74_E	0.723	0.30
79_V	87_L	0.723	0.30
48_I	56_G	0.722	0.30
65_E	147_M	0.720	0.30
40_Q	141_L	0.710	0.30
115_V	123_K	0.709	0.30
23_N	192_R	0.706	0.29
144_Q	176_R	0.705	0.29
17_R	99_K	0.704	0.29
61_L	64_A	0.704	0.29
163_P	177_V	0.698	0.29
186_P	200_R	0.697	0.29
108_T	159_L	0.695	0.29
4_F	10_A	0.695	0.29
115_V	145_R	0.693	0.29
184_Q	197_M	0.693	0.29
9_G	111_V	0.691	0.29
44_L	56_G	0.686	0.28
63_L	157_I	0.684	0.28
130_P	147_M	0.678	0.28
30_Q	162_E	0.676	0.28
47_R	195_R	0.671	0.27
14_R	18_R	0.671	0.27
8_L	13_K	0.669	0.27
174_L	181_E	0.665	0.27
17_R	202_Q	0.663	0.27
15_R	41_L	0.662	0.27
87_L	181_E	0.660	0.27
49_A	189_V	0.659	0.27
167_P	196_Q	0.658	0.27
127_P	202_Q	0.657	0.27
20_L	104_D	0.655	0.27
188_K	197_M	0.655	0.27
130_P	145_R	0.655	0.27
45_K	63_L	0.654	0.26
68_P	188_K	0.652	0.26
115_V	125_K	0.652	0.26
106_K	110_Y	0.650	0.26
154_Q	189_V	0.648	0.26
153_K	174_L	0.645	0.26
91_T	94_D	0.642	0.26
57_I	60_D	0.639	0.26
142_R	177_V	0.638	0.26
131_L	155_E	0.636	0.25
31_Q	59_E	0.635	0.25
184_Q	187_T	0.632	0.25
135_K	169_V	0.631	0.25
110_Y	188_K	0.631	0.25
33_E	52_A	0.630	0.25
107_I	187_T	0.629	0.25
146_R	177_V	0.627	0.25
140_K	149_E	0.624	0.25
126_P	154_Q	0.623	0.25
76_P	80_E	0.620	0.25
51_A	55_A	0.613	0.24
188_K	209_E	0.613	0.24
111_V	124_N	0.612	0.24
31_Q	181_E	0.611	0.24
17_R	136_K	0.606	0.24
14_R	97_D	0.603	0.24
182_A	189_V	0.602	0.24
39_A	52_A	0.595	0.23
145_R	159_L	0.595	0.23
55_A	110_Y	0.594	0.23
169_V	176_R	0.591	0.23
123_K	150_L	0.590	0.23
45_K	54_K	0.587	0.23
60_D	136_K	0.584	0.23
143_R	183_V	0.584	0.23
44_L	52_A	0.583	0.23
31_Q	41_L	0.581	0.23
55_A	64_A	0.581	0.23
41_L	49_A	0.579	0.23
20_L	171_L	0.577	0.22
88_P	103_K	0.574	0.22
78_D	153_K	0.574	0.22
79_V	95_I	0.573	0.22
43_E	96_D	0.573	0.22
70_V	106_K	0.569	0.22
153_K	193_V	0.566	0.22
125_K	206_E	0.566	0.22
185_D	213_L	0.562	0.22
52_A	157_I	0.560	0.22
48_I	53_R	0.559	0.22
90_K	126_P	0.555	0.21
208_N	211_R	0.552	0.21
135_K	178_L	0.551	0.21
181_E	195_R	0.551	0.21
153_K	168_K	0.549	0.21
81_W	130_P	0.548	0.21
173_N	190_E	0.544	0.21
143_R	156_K	0.544	0.21
51_A	166_P	0.542	0.21
45_K	60_D	0.539	0.21
17_R	27_K	0.536	0.20
170_K	175_M	0.536	0.20
32_A	120_P	0.535	0.20
43_E	46_K	0.533	0.20
14_R	171_L	0.531	0.20
179_G	196_Q	0.529	0.20
150_L	203_A	0.523	0.20
79_V	84_E	0.523	0.20
208_N	213_L	0.522	0.20
45_K	72_E	0.519	0.20
107_I	179_G	0.518	0.20
59_E	65_E	0.516	0.20
134_T	167_P	0.515	0.20
16_K	37_R	0.514	0.19
151_K	181_E	0.513	0.19
140_K	175_M	0.513	0.19
56_G	63_L	0.509	0.19
37_R	44_L	0.507	0.19
59_E	70_V	0.507	0.19
143_R	211_R	0.507	0.19
115_V	171_L	0.505	0.19
25_K	154_Q	0.505	0.19
135_K	154_Q	0.504	0.19
32_A	40_Q	0.503	0.19
63_L	66_K	0.503	0.19
10_A	24_E	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3zs9C	1	0.1449	6.1	0.966	Contact Map
3r3tA	3	0.1869	5	0.968	Contact Map
4ql0A	2	0.3879	5	0.968	Contact Map
2rmgA	1	0.1776	4.2	0.969	Contact Map
2jxcB	1	0.1215	3.7	0.97	Contact Map
3sjdD	1	0.1215	3.7	0.97	Contact Map
2rmhA	1	0.1776	3.4	0.97	Contact Map
4o9bA	3	0.1822	3.4	0.97	Contact Map
2b9sB	1	0.1355	3.2	0.971	Contact Map
4g9jC	1	0.0607	2.9	0.971	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.