Yos1 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Yos1 - Yos1-like

PFAM:	PF08571	Sequences: LGTLLEAALLLLNAIAILNEDRFLAKIGWSSGFGQGDEPSVKAQIINLISAVRTLMRIPLIALNILVIVYELLLG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	75 (75)
Sequences:	557 (419)
Seq/√Len:	48.3
META:	0.368

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
9_L	67_V	3.196	1.00
70_Y	74_L	3.008	1.00
20_E	53_R	2.759	1.00
15_I	49_I	2.737	1.00
2_G	6_E	2.236	1.00
18_L	23_F	2.113	1.00
16_A	60_L	1.924	0.99
69_V	73_L	1.856	0.99
47_N	55_L	1.720	0.98
45_I	50_S	1.638	0.98
62_A	65_I	1.602	0.97
3_T	6_E	1.601	0.97
66_L	70_Y	1.585	0.97
6_E	71_E	1.470	0.96
16_A	57_R	1.439	0.95
2_G	70_Y	1.381	0.94
8_A	36_G	1.356	0.93
50_S	55_L	1.341	0.93
2_G	55_L	1.341	0.93
11_L	14_A	1.340	0.93
57_R	63_L	1.289	0.92
14_A	42_K	1.269	0.91
11_L	15_I	1.208	0.89
53_R	72_L	1.208	0.89
58_I	61_I	1.197	0.88
49_I	56_M	1.196	0.88
29_W	42_K	1.175	0.87
39_P	44_Q	1.172	0.87
52_V	65_I	1.166	0.87
28_G	31_S	1.165	0.87
14_A	20_E	1.150	0.86
63_L	67_V	1.138	0.85
20_E	29_W	1.137	0.85
6_E	74_L	1.130	0.85
29_W	45_I	1.060	0.81
15_I	46_I	1.050	0.80
31_S	55_L	1.043	0.80
29_W	46_I	1.040	0.80
16_A	52_V	1.014	0.78
6_E	26_K	1.004	0.77
11_L	73_L	0.990	0.76
30_S	50_S	0.974	0.75
37_D	40_S	0.972	0.75
12_L	56_M	0.970	0.75
46_I	49_I	0.949	0.73
35_Q	65_I	0.943	0.73
23_F	46_I	0.941	0.73
65_I	69_V	0.940	0.73
17_I	21_D	0.924	0.71
41_V	56_M	0.909	0.70
59_P	64_N	0.908	0.70
21_D	30_S	0.882	0.68
27_I	30_S	0.855	0.65
65_I	71_E	0.851	0.65
33_F	36_G	0.850	0.65
7_A	10_L	0.847	0.64
14_A	25_A	0.835	0.63
3_T	8_A	0.834	0.63
11_L	69_V	0.831	0.63
16_A	46_I	0.829	0.63
6_E	70_Y	0.793	0.59
49_I	57_R	0.775	0.58
21_D	29_W	0.772	0.57
32_G	36_G	0.771	0.57
31_S	41_V	0.758	0.56
26_K	44_Q	0.756	0.56
46_I	51_A	0.750	0.55
10_L	61_I	0.745	0.55
1_L	4_L	0.737	0.54
51_A	62_A	0.734	0.54
46_I	71_E	0.727	0.53
41_V	47_N	0.725	0.53
8_A	12_L	0.723	0.52
3_T	7_A	0.720	0.52
12_L	16_A	0.708	0.51
8_A	14_A	0.700	0.50
67_V	73_L	0.695	0.50
17_I	33_F	0.692	0.49
12_L	52_V	0.690	0.49
51_A	54_T	0.689	0.49
47_N	51_A	0.680	0.48
37_D	66_L	0.678	0.48
3_T	9_L	0.677	0.48
72_L	75_G	0.674	0.47
52_V	72_L	0.669	0.47
8_A	37_D	0.661	0.46
63_L	73_L	0.646	0.45
5_L	66_L	0.642	0.44
41_V	45_I	0.639	0.44
8_A	25_A	0.624	0.42
14_A	32_G	0.609	0.41
51_A	55_L	0.598	0.40
9_L	51_A	0.596	0.40
15_I	61_I	0.590	0.39
32_G	53_R	0.583	0.39
14_A	65_I	0.580	0.38
20_E	48_L	0.576	0.38
30_S	34_G	0.576	0.38
10_L	14_A	0.574	0.38
20_E	60_L	0.564	0.37
30_S	46_I	0.563	0.37
28_G	42_K	0.556	0.36
40_S	56_M	0.553	0.36
10_L	13_N	0.544	0.35
14_A	64_N	0.542	0.35
38_E	65_I	0.541	0.35
36_G	43_A	0.536	0.34
38_E	43_A	0.533	0.34
44_Q	50_S	0.533	0.34
1_L	5_L	0.511	0.32
16_A	20_E	0.501	0.31
35_Q	38_E	0.500	0.31

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2mv6A	1	0.4	25.2	0.884	Contact Map
2q7rA	3	0.48	4.2	0.919	Contact Map
4g80S	1	0.4533	3.4	0.923	Contact Map
2jo1A	1	0.7067	3.2	0.924	Contact Map
4akgA	2	0.9333	2.9	0.925	Contact Map
4z7fA	2	0.4	2.7	0.926	Contact Map
2mkvA	1	0.52	2.4	0.928	Contact Map
3m66A	1	0.56	2.1	0.93	Contact Map
3tixB	1	0.3867	2	0.931	Contact Map
3dtgA	2	0.84	1.8	0.933	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.