DUF1761 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1761 - Protein of unknown function (DUF1761)

PFAM:	PF08570	Sequences: LAVLVAAVAAFVLGALWYSPLFGKAWMKAAGLTEEDLKAPGNMAKIFGLSFVASLVMAYVLAHLLGALGAGTTLGHGALLGFLLWLGFVAPTLLINYLFEGRPWKLFLINAGYWLVGLLLMGAILG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	126 (124)
Sequences:	15787 (11767)
Seq/√Len:	1056.7
META:	0.948

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
60_V	87_G	2.766	1.00
74_L	123_A	2.565	1.00
85_W	115_L	2.408	1.00
29_A	105_K	2.350	1.00
58_A	121_M	2.349	1.00
13_L	120_L	2.293	1.00
97_Y	107_F	2.267	1.00
25_A	28_K	2.141	1.00
29_A	103_P	2.138	1.00
10_A	117_G	2.127	1.00
25_A	105_K	2.098	1.00
7_A	55_L	2.034	1.00
44_A	48_G	1.970	1.00
100_E	110_N	1.947	1.00
13_L	116_V	1.867	1.00
94_L	107_F	1.847	1.00
78_A	119_L	1.832	1.00
82_F	119_L	1.828	1.00
27_M	34_E	1.788	1.00
75_G	79_L	1.760	1.00
64_L	84_L	1.747	1.00
34_E	38_K	1.660	1.00
25_A	29_A	1.659	1.00
93_L	111_A	1.652	1.00
77_G	81_G	1.635	1.00
9_A	124_I	1.544	1.00
7_A	51_F	1.521	1.00
77_G	122_G	1.479	1.00
10_A	121_M	1.467	1.00
53_A	94_L	1.463	1.00
32_L	36_D	1.422	1.00
90_A	107_F	1.420	1.00
33_T	36_D	1.420	1.00
104_W	108_L	1.403	1.00
20_P	23_G	1.400	1.00
63_H	67_A	1.337	1.00
25_A	109_I	1.333	1.00
33_T	37_L	1.330	1.00
57_M	118_L	1.322	1.00
73_T	76_H	1.277	1.00
90_A	111_A	1.274	1.00
11_F	15_A	1.268	1.00
76_H	80_L	1.258	1.00
62_A	66_G	1.241	1.00
12_V	15_A	1.236	1.00
16_L	21_L	1.232	1.00
79_L	83_L	1.217	1.00
107_F	111_A	1.204	1.00
46_I	98_L	1.191	1.00
7_A	58_A	1.178	1.00
29_A	106_L	1.172	1.00
17_W	22_F	1.159	1.00
10_A	54_S	1.149	1.00
36_D	39_A	1.124	1.00
39_A	42_N	1.117	1.00
32_L	37_L	1.106	1.00
50_S	99_F	1.097	1.00
9_A	120_L	1.085	1.00
50_S	95_I	1.064	1.00
76_H	79_L	1.061	1.00
63_H	83_L	1.055	1.00
6_A	125_L	1.041	1.00
24_K	28_K	1.038	1.00
14_G	113_Y	1.036	1.00
96_N	114_W	1.035	1.00
38_K	41_G	1.032	1.00
96_N	100_E	1.019	1.00
35_E	38_K	1.017	1.00
4_L	51_F	1.008	1.00
54_S	58_A	1.000	1.00
49_L	98_L	0.993	1.00
23_G	27_M	0.983	1.00
50_S	54_S	0.977	1.00
13_L	113_Y	0.976	1.00
93_L	107_F	0.972	1.00
53_A	91_P	0.971	1.00
64_L	80_L	0.962	1.00
40_P	43_M	0.955	1.00
118_L	122_G	0.950	1.00
106_L	110_N	0.944	1.00
113_Y	117_G	0.942	1.00
60_V	63_H	0.940	1.00
89_V	118_L	0.928	1.00
78_A	123_A	0.927	1.00
20_P	24_K	0.909	1.00
89_V	92_T	0.899	1.00
94_L	97_Y	0.893	1.00
74_L	78_A	0.892	1.00
117_G	121_M	0.886	1.00
17_W	112_G	0.882	1.00
72_T	76_H	0.861	1.00
62_A	125_L	0.849	1.00
24_K	27_M	0.847	1.00
45_K	49_L	0.841	1.00
85_W	90_A	0.834	1.00
6_A	121_M	0.834	1.00
70_A	76_H	0.826	1.00
59_Y	63_H	0.823	1.00
95_I	114_W	0.820	1.00
64_L	68_L	0.816	1.00
65_L	80_L	0.810	1.00
18_Y	110_N	0.804	1.00
34_E	37_L	0.799	1.00
84_L	88_F	0.791	1.00
85_W	111_A	0.786	1.00
21_L	24_K	0.785	1.00
28_K	105_K	0.776	1.00
63_H	66_G	0.765	1.00
47_F	51_F	0.755	1.00
80_L	84_L	0.738	1.00
45_K	48_G	0.737	1.00
6_A	10_A	0.736	1.00
65_L	125_L	0.710	1.00
87_G	91_P	0.709	1.00
49_L	94_L	0.706	1.00
65_L	70_A	0.706	1.00
93_L	96_N	0.705	1.00
60_V	83_L	0.705	1.00
46_I	49_L	0.695	1.00
97_Y	104_W	0.694	1.00
109_I	112_G	0.693	1.00
63_H	79_L	0.690	1.00
111_A	115_L	0.687	1.00
48_G	52_V	0.685	1.00
95_I	99_F	0.684	1.00
19_S	23_G	0.684	1.00
60_V	64_L	0.675	1.00
9_A	13_L	0.664	1.00
66_G	70_A	0.663	1.00
93_L	114_W	0.662	1.00
93_L	97_Y	0.652	1.00
119_L	123_A	0.650	1.00
79_L	82_F	0.643	1.00
51_F	55_L	0.642	1.00
6_A	9_A	0.635	1.00
13_L	117_G	0.632	1.00
53_A	98_L	0.631	1.00
37_L	41_G	0.618	1.00
115_L	119_L	0.615	1.00
36_D	40_P	0.610	1.00
97_Y	100_E	0.609	1.00
81_G	85_W	0.609	1.00
57_M	91_P	0.607	1.00
2_A	5_V	0.607	1.00
30_A	34_E	0.589	1.00
32_L	101_G	0.588	1.00
58_A	125_L	0.586	1.00
35_E	39_A	0.586	1.00
75_G	78_A	0.583	1.00
97_Y	106_L	0.582	1.00
57_M	92_T	0.581	1.00
7_A	11_F	0.579	1.00
27_M	32_L	0.578	1.00
49_L	53_A	0.576	1.00
4_L	7_A	0.573	1.00
29_A	109_I	0.572	1.00
11_F	54_S	0.570	1.00
82_F	115_L	0.568	1.00
114_W	117_G	0.558	1.00
15_A	19_S	0.553	1.00
6_A	124_I	0.552	1.00
61_L	88_F	0.548	1.00
55_L	59_Y	0.547	1.00
56_V	91_P	0.546	1.00
19_S	24_K	0.545	1.00
74_L	77_G	0.543	1.00
89_V	114_W	0.543	1.00
20_P	27_M	0.541	1.00
67_A	70_A	0.540	1.00
54_S	57_M	0.537	1.00
64_L	67_A	0.531	1.00
94_L	104_W	0.522	1.00
16_L	20_P	0.520	1.00
16_L	19_S	0.519	1.00
37_L	40_P	0.516	1.00
1_L	4_L	0.514	1.00
119_L	122_G	0.511	1.00
12_V	16_L	0.508	1.00
104_W	107_F	0.506	1.00
11_F	51_F	0.505	1.00
56_V	87_G	0.502	1.00
103_P	106_L	0.502	1.00
32_L	35_E	0.502	1.00
59_Y	83_L	0.501	1.00
15_A	47_F	0.501	1.00
92_T	114_W	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3qnqA	2	0.3254	31	0.855	Contact Map
1ldfA	3	0.2063	7.8	0.89	Contact Map
3giaA	1	0.2698	4.9	0.899	Contact Map
3aqpA	1	0.2222	4.2	0.903	Contact Map
3zuxA	1	0.1984	4.2	0.903	Contact Map
4he8N	1	0.5556	4	0.904	Contact Map
4av3A	2	0.8968	3.9	0.905	Contact Map
4wfeA	2	0.9444	3	0.91	Contact Map
1m56C	2	0.9206	3	0.91	Contact Map
4a01A	2	0.9206	2.8	0.911	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0078 seconds.