DUF1754 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1754 - Eukaryotic family of unknown function (DUF1754)

PFAM:	PF08555	Sequences: EYDNVVGGKLKLKGKKLDVKGVKKKKKKKKKKSKEKEEAASEEEEAEKSSAESDAESEEEEDEESDESGEEEEEESSDDHKTEAERRFEEQRRKRLEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	98 (95)
Sequences:	550 (498)
Seq/√Len:	51.1
META:	0.278

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
81_K	89_E	3.739	1.00
88_F	92_R	3.392	1.00
81_K	93_R	2.709	1.00
83_E	87_R	2.503	1.00
9_K	88_F	2.273	1.00
89_E	93_R	2.127	1.00
81_K	96_L	2.045	1.00
78_D	86_R	2.029	1.00
79_D	83_E	1.973	1.00
90_E	93_R	1.970	1.00
81_K	86_R	1.953	0.99
6_V	9_K	1.910	0.99
9_K	91_Q	1.826	0.99
88_F	91_Q	1.793	0.99
84_A	87_R	1.754	0.99
87_R	90_E	1.711	0.99
83_E	86_R	1.681	0.98
58_E	61_E	1.653	0.98
93_R	96_L	1.651	0.98
2_Y	5_V	1.619	0.98
10_L	13_K	1.519	0.97
15_K	18_D	1.513	0.97
89_E	92_R	1.445	0.96
9_K	81_K	1.385	0.95
24_K	27_K	1.365	0.95
23_K	29_K	1.347	0.94
91_Q	95_R	1.313	0.93
6_V	21_G	1.297	0.93
77_S	93_R	1.263	0.92
63_E	68_S	1.229	0.91
37_E	40_A	1.213	0.90
6_V	88_F	1.208	0.90
5_V	9_K	1.194	0.89
31_K	34_K	1.188	0.89
60_E	66_D	1.171	0.88
92_R	96_L	1.124	0.86
34_K	38_E	1.104	0.85
38_E	43_E	1.096	0.85
64_E	72_E	1.086	0.84
19_V	80_H	1.081	0.84
87_R	97_E	1.081	0.84
86_R	92_R	1.078	0.84
64_E	69_G	1.056	0.83
62_D	66_D	1.048	0.82
19_V	97_E	1.046	0.82
11_K	83_E	1.034	0.81
28_K	31_K	1.024	0.81
48_K	51_A	1.000	0.79
60_E	63_E	0.996	0.79
81_K	90_E	0.994	0.79
29_K	32_K	0.988	0.78
1_E	4_N	0.985	0.78
14_G	26_K	0.965	0.77
45_E	52_E	0.962	0.76
43_E	47_E	0.959	0.76
49_S	53_S	0.957	0.76
79_D	86_R	0.957	0.76
3_D	6_V	0.946	0.75
89_E	96_L	0.945	0.75
59_E	65_S	0.943	0.75
59_E	67_E	0.937	0.74
46_A	50_S	0.932	0.74
9_K	15_K	0.926	0.74
62_D	65_S	0.914	0.73
40_A	51_A	0.910	0.72
7_G	15_K	0.902	0.72
40_A	49_S	0.900	0.71
46_A	49_S	0.884	0.70
33_S	45_E	0.873	0.69
50_S	53_S	0.854	0.67
1_E	85_E	0.854	0.67
50_S	76_S	0.839	0.66
8_G	13_K	0.837	0.66
15_K	81_K	0.828	0.65
63_E	66_D	0.819	0.64
86_R	90_E	0.797	0.62
4_N	52_E	0.771	0.59
25_K	95_R	0.768	0.59
56_E	64_E	0.765	0.59
85_E	88_F	0.760	0.58
35_E	38_E	0.759	0.58
45_E	49_S	0.745	0.57
39_A	42_E	0.733	0.56
44_E	50_S	0.720	0.54
32_K	37_E	0.714	0.54
91_Q	97_E	0.712	0.53
34_K	37_E	0.704	0.53
38_E	54_D	0.691	0.51
38_E	41_S	0.686	0.51
37_E	49_S	0.678	0.50
56_E	70_E	0.676	0.50
33_S	36_K	0.670	0.49
60_E	64_E	0.669	0.49
60_E	65_S	0.664	0.48
3_D	16_K	0.661	0.48
8_G	14_G	0.660	0.48
50_S	54_D	0.658	0.48
64_E	67_E	0.652	0.47
11_K	95_R	0.649	0.47
3_D	9_K	0.646	0.47
70_E	73_E	0.643	0.46
9_K	95_R	0.638	0.46
56_E	62_D	0.637	0.46
11_K	22_V	0.624	0.44
5_V	88_F	0.619	0.44
3_D	83_E	0.607	0.43
54_D	65_S	0.599	0.42
7_G	89_E	0.597	0.42
80_H	91_Q	0.594	0.41
2_Y	14_G	0.593	0.41
79_D	93_R	0.592	0.41
85_E	96_L	0.592	0.41
80_H	87_R	0.589	0.41
49_S	62_D	0.584	0.40
26_K	90_E	0.583	0.40
57_S	60_E	0.581	0.40
17_L	83_E	0.581	0.40
16_K	81_K	0.579	0.40
6_V	16_K	0.578	0.40
83_E	93_R	0.575	0.39
44_E	47_E	0.575	0.39
83_E	96_L	0.565	0.38
44_E	48_K	0.565	0.38
39_A	43_E	0.558	0.38
57_S	70_E	0.551	0.37
1_E	5_V	0.550	0.37
92_R	97_E	0.547	0.37
47_E	52_E	0.544	0.36
25_K	85_E	0.538	0.36
61_E	72_E	0.537	0.36
65_S	68_S	0.533	0.35
51_A	54_D	0.532	0.35
67_E	72_E	0.532	0.35
57_S	62_D	0.531	0.35
37_E	42_E	0.528	0.35
69_G	76_S	0.528	0.35
43_E	46_A	0.522	0.34
6_V	81_K	0.515	0.34
67_E	71_E	0.512	0.33
44_E	51_A	0.512	0.33
59_E	62_D	0.512	0.33
39_A	44_E	0.500	0.32

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2zetC	1	0.2449	4.6	0.89	Contact Map
2q8kA	1	0.1735	3.2	0.897	Contact Map
4ipaA	1	0.1327	3	0.899	Contact Map
1914A	1	0.4184	2.8	0.901	Contact Map
1v7mV	1	0.2245	2.7	0.902	Contact Map
2k5kA	1	0.2959	2.4	0.904	Contact Map
4jgxA	2	0.3367	2.3	0.906	Contact Map
4yhuA	1	0	2	0.908	Contact Map
4mqvB	1	0.1837	1.9	0.909	Contact Map
3sgrA	5	0.1837	1.7	0.912	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.