MBF1 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MBF1 - Multiprotein bridging factor 1

PFAM:	PF08523	Sequences: QDWDPVTVIGKKAPKATVAKSESAVNAARRSGAVVETEKKFGAGGNKQHSGTEGQNAAKLDRETEELKHKKV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	72 (72)
Sequences:	854 (583)
Seq/√Len:	68.6
META:	0.509

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
58_A	62_R	5.205	1.00
22_E	29_R	3.661	1.00
26_N	29_R	2.563	1.00
21_S	24_A	2.385	1.00
54_G	57_A	2.069	1.00
1_Q	4_D	1.999	1.00
27_A	30_R	1.911	1.00
42_G	45_G	1.891	1.00
63_E	67_L	1.888	1.00
26_N	30_R	1.863	1.00
1_Q	8_V	1.839	1.00
25_V	34_V	1.657	0.99
21_S	25_V	1.648	0.99
63_E	66_E	1.529	0.99
2_D	5_P	1.484	0.99
25_V	35_V	1.482	0.99
53_E	56_N	1.482	0.99
60_L	69_H	1.355	0.98
68_K	71_K	1.346	0.98
27_A	31_S	1.322	0.97
29_R	35_V	1.319	0.97
56_N	62_R	1.317	0.97
53_E	57_A	1.300	0.97
19_A	27_A	1.266	0.96
7_T	11_K	1.260	0.96
1_Q	7_T	1.224	0.96
23_S	27_A	1.187	0.95
19_A	25_V	1.176	0.95
57_A	67_L	1.172	0.94
31_S	36_E	1.060	0.91
25_V	30_R	1.033	0.90
64_T	68_K	1.022	0.89
66_E	69_H	1.019	0.89
11_K	14_P	1.015	0.89
63_E	68_K	1.013	0.89
55_Q	69_H	1.009	0.89
61_D	64_T	1.006	0.89
41_F	44_G	0.983	0.87
20_K	23_S	0.958	0.86
49_H	52_T	0.939	0.85
43_A	47_K	0.927	0.84
57_A	60_L	0.918	0.84
15_K	18_V	0.908	0.83
18_V	24_A	0.895	0.82
39_K	42_G	0.889	0.81
57_A	61_D	0.876	0.81
14_P	18_V	0.857	0.79
64_T	67_L	0.850	0.79
18_V	23_S	0.823	0.76
1_Q	5_P	0.808	0.75
40_K	61_D	0.807	0.75
10_G	14_P	0.802	0.74
26_N	58_A	0.784	0.73
17_T	22_E	0.773	0.72
24_A	36_E	0.767	0.71
39_K	46_N	0.755	0.70
10_G	13_A	0.750	0.69
25_V	36_E	0.746	0.69
19_A	22_E	0.744	0.69
62_R	66_E	0.734	0.68
23_S	29_R	0.732	0.67
17_T	29_R	0.732	0.67
59_K	65_E	0.726	0.67
20_K	61_D	0.725	0.67
7_T	38_E	0.717	0.66
6_V	10_G	0.715	0.66
10_G	20_K	0.702	0.64
50_S	59_K	0.691	0.63
39_K	54_G	0.679	0.62
40_K	46_N	0.669	0.60
24_A	31_S	0.665	0.60
51_G	65_E	0.664	0.60
9_I	13_A	0.650	0.58
39_K	68_K	0.644	0.58
30_R	61_D	0.640	0.57
36_E	45_G	0.639	0.57
30_R	40_K	0.636	0.57
53_E	60_L	0.635	0.57
26_N	55_Q	0.629	0.56
28_A	37_T	0.628	0.56
40_K	71_K	0.610	0.54
29_R	33_A	0.603	0.53
37_T	70_K	0.603	0.53
23_S	58_A	0.598	0.52
1_Q	44_G	0.595	0.52
16_A	40_K	0.589	0.51
47_K	51_G	0.586	0.51
25_V	28_A	0.584	0.50
68_K	72_V	0.559	0.47
5_P	8_V	0.553	0.47
23_S	26_N	0.543	0.46
26_N	34_V	0.535	0.45
52_T	60_L	0.535	0.45
37_T	43_A	0.532	0.44
9_I	28_A	0.531	0.44
54_G	70_K	0.531	0.44
29_R	48_Q	0.528	0.44
46_N	65_E	0.520	0.43
9_I	12_K	0.517	0.42
56_N	60_L	0.517	0.42
1_Q	9_I	0.515	0.42
1_Q	23_S	0.506	0.41
25_V	37_T	0.506	0.41
31_S	56_N	0.504	0.41
3_W	59_K	0.503	0.41
67_L	71_K	0.502	0.41
1_Q	21_S	0.502	0.41
34_V	57_A	0.500	0.40

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4n6hA	1	0.9444	5	0.893	Contact Map
3he5A	1	0.3611	2.9	0.905	Contact Map
3zx7A	1	0.75	2	0.913	Contact Map
1k04A	2	0.3056	1.4	0.921	Contact Map
3kptA	1	0.375	1.3	0.922	Contact Map
3j20F	1	0.7778	1.2	0.922	Contact Map
4yayA	1	0.9583	1	0.927	Contact Map
3zeyP	1	0.7778	1	0.927	Contact Map
2jvlA	1	0.4306	0.9	0.928	Contact Map
1dugA	2	0.4722	0.9	0.928	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0041 seconds.