DUF1737 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1737 - Domain of unknown function (DUF1737)

PFAM:	PF08410	Sequences: MKLYRLLTGPDDAAFCHRVSEALAEGWELYGSPAVTFDGETGRVICAQAVVKE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	53 (50)
Sequences:	3904 (2185)
Seq/√Len:	309.0
META:	0.912

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
5_R	22_A	2.904	1.00
23_L	29_L	2.416	1.00
5_R	16_C	2.128	1.00
33_P	49_A	1.902	1.00
6_L	16_C	1.743	1.00
21_E	25_E	1.724	1.00
13_A	17_H	1.685	1.00
7_L	22_A	1.649	1.00
30_Y	33_P	1.560	1.00
34_A	47_A	1.523	1.00
6_L	47_A	1.503	1.00
22_A	25_E	1.488	1.00
3_L	52_K	1.445	1.00
35_V	47_A	1.394	1.00
20_S	24_A	1.376	1.00
35_V	46_C	1.338	1.00
10_P	43_R	1.329	1.00
18_R	21_E	1.323	1.00
3_L	20_S	1.297	1.00
9_G	18_R	1.245	1.00
38_D	43_R	1.239	1.00
32_S	49_A	1.236	1.00
37_F	40_E	1.235	1.00
5_R	50_V	1.126	1.00
3_L	24_A	1.121	1.00
3_L	27_W	1.110	1.00
6_L	33_P	1.081	1.00
19_V	50_V	1.007	1.00
7_L	50_V	0.992	1.00
9_G	12_D	0.938	1.00
39_G	43_R	0.933	1.00
12_D	16_C	0.922	1.00
9_G	14_A	0.908	1.00
7_L	15_F	0.907	1.00
29_L	51_V	0.839	1.00
9_G	15_F	0.830	1.00
17_H	21_E	0.819	1.00
36_T	44_V	0.818	1.00
16_C	20_S	0.815	1.00
36_T	47_A	0.812	1.00
40_E	43_R	0.796	1.00
35_V	44_V	0.779	0.99
35_V	45_I	0.755	0.99
11_D	14_A	0.754	0.99
7_L	19_V	0.751	0.99
6_L	46_C	0.750	0.99
28_E	51_V	0.746	0.99
30_Y	51_V	0.743	0.99
8_T	47_A	0.736	0.99
38_D	41_T	0.731	0.99
14_A	18_R	0.697	0.99
33_P	46_C	0.665	0.98
10_P	45_I	0.658	0.98
30_Y	49_A	0.657	0.98
17_H	25_E	0.657	0.98
15_F	50_V	0.643	0.98
20_S	23_L	0.638	0.98
22_A	50_V	0.629	0.98
29_L	32_S	0.626	0.98
20_S	52_K	0.613	0.97
14_A	17_H	0.603	0.97
27_W	51_V	0.598	0.97
27_W	50_V	0.593	0.97
13_A	21_E	0.581	0.96
8_T	12_D	0.574	0.96
12_D	46_C	0.572	0.96
11_D	17_H	0.563	0.96
8_T	46_C	0.559	0.95
37_F	43_R	0.546	0.95
36_T	42_G	0.543	0.95
11_D	15_F	0.537	0.94
3_L	21_E	0.522	0.93
8_T	45_I	0.522	0.93
20_S	27_W	0.505	0.92
4_Y	7_L	0.500	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2uw1A	2	1	27	0.813	Contact Map
3s5jB	2	0.9057	25.4	0.815	Contact Map
4fbdA	2	0.9434	23.5	0.818	Contact Map
3dahA	5	0.9245	23	0.819	Contact Map
3tx2A	1	1	21.7	0.821	Contact Map
2pd0A	2	0.9811	21.3	0.822	Contact Map
3icoA	1	0.9623	17.9	0.828	Contact Map
4tm7A	1	0.9811	16.9	0.83	Contact Map
2ji4A	5	0.9057	16.8	0.83	Contact Map
3bvxA	1	0.9245	15.9	0.832	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0039 seconds.