Chitin_synth_1N - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Chitin_synth_1N - Chitin synthase N-terminal

PFAM:	PF08407	Sequences: KTTKKVKLTNGNLVLDCPVPSKLLNALPRRETDSEEFTHMRYTAATCDPDDFTKNGYTLRQALYGRETELFIVIT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	75 (73)
Sequences:	645 (340)
Seq/√Len:	39.7
META:	0.304

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
43_T	57_Y	4.237	1.00
51_D	55_N	2.676	1.00
51_D	54_K	2.547	1.00
8_L	42_Y	2.260	1.00
18_P	64_Y	2.248	1.00
16_D	35_E	1.999	0.99
19_V	23_L	1.929	0.99
12_N	43_T	1.828	0.98
46_T	72_I	1.827	0.98
52_F	59_L	1.745	0.97
4_K	23_L	1.673	0.96
3_T	26_A	1.601	0.95
11_G	14_V	1.583	0.95
16_D	41_R	1.507	0.94
19_V	41_R	1.479	0.93
20_P	48_D	1.353	0.89
18_P	39_H	1.349	0.89
17_C	23_L	1.251	0.85
7_K	74_I	1.244	0.85
21_S	26_A	1.230	0.84
29_R	33_D	1.226	0.84
25_N	51_D	1.213	0.83
36_E	66_R	1.176	0.81
13_L	40_M	1.164	0.81
68_T	72_I	1.152	0.80
35_E	39_H	1.151	0.80
9_T	12_N	1.143	0.79
23_L	28_P	1.141	0.79
37_F	40_M	1.141	0.79
14_V	22_K	1.133	0.79
48_D	69_E	1.122	0.78
30_R	33_D	1.115	0.78
8_L	47_C	1.100	0.77
47_C	63_L	1.071	0.75
30_R	65_G	1.051	0.73
62_A	74_I	1.034	0.72
19_V	48_D	1.026	0.71
42_Y	48_D	1.023	0.71
30_R	70_L	1.022	0.71
42_Y	75_T	1.019	0.71
2_T	15_L	1.016	0.71
56_G	62_A	0.992	0.69
6_V	48_D	0.982	0.68
2_T	23_L	0.971	0.67
24_L	27_L	0.970	0.67
20_P	63_L	0.964	0.67
27_L	39_H	0.948	0.65
37_F	58_T	0.937	0.64
27_L	55_N	0.932	0.64
56_G	64_Y	0.928	0.64
34_S	57_Y	0.917	0.63
69_E	72_I	0.898	0.61
67_E	73_V	0.889	0.60
29_R	34_S	0.864	0.58
44_A	60_R	0.860	0.58
20_P	53_T	0.859	0.58
28_P	37_F	0.812	0.53
49_P	72_I	0.806	0.53
40_M	44_A	0.800	0.52
45_A	48_D	0.796	0.52
37_F	56_G	0.795	0.52
23_L	61_Q	0.795	0.52
18_P	40_M	0.788	0.51
57_Y	61_Q	0.786	0.51
22_K	25_N	0.785	0.51
12_N	57_Y	0.779	0.50
10_N	56_G	0.772	0.50
37_F	73_V	0.759	0.48
23_L	27_L	0.752	0.48
56_G	63_L	0.749	0.48
30_R	34_S	0.737	0.46
41_R	72_I	0.704	0.43
39_H	71_F	0.703	0.43
61_Q	74_I	0.698	0.43
21_S	57_Y	0.693	0.43
13_L	44_A	0.689	0.42
53_T	62_A	0.685	0.42
60_R	66_R	0.681	0.41
61_Q	69_E	0.681	0.41
16_D	40_M	0.679	0.41
25_N	30_R	0.678	0.41
4_K	54_K	0.661	0.40
58_T	63_L	0.647	0.38
34_S	64_Y	0.646	0.38
17_C	37_F	0.644	0.38
62_A	67_E	0.637	0.38
44_A	57_Y	0.621	0.36
53_T	71_F	0.620	0.36
20_P	43_T	0.616	0.36
54_K	61_Q	0.593	0.34
21_S	42_Y	0.586	0.33
26_A	73_V	0.583	0.33
57_Y	74_I	0.582	0.33
9_T	65_G	0.580	0.33
59_L	66_R	0.576	0.33
26_A	45_A	0.574	0.32
17_C	40_M	0.567	0.32
33_D	38_T	0.566	0.32
36_E	49_P	0.566	0.32
45_A	53_T	0.556	0.31
45_A	56_G	0.555	0.31
7_K	63_L	0.555	0.31
29_R	32_T	0.547	0.30
28_P	33_D	0.528	0.29
39_H	43_T	0.522	0.28
23_L	29_R	0.520	0.28
41_R	70_L	0.520	0.28
12_N	18_P	0.505	0.27
48_D	70_L	0.504	0.27
14_V	28_P	0.500	0.27

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3bh1A	4	0.72	11.5	0.915	Contact Map
2hcuA	1	0.8933	5.6	0.926	Contact Map
2j5lA	1	0	5.1	0.927	Contact Map
2axoA	2	0.9067	4.8	0.928	Contact Map
4hn1A	3	0.8267	4.7	0.929	Contact Map
2uvaG	3	0.9067	4.4	0.929	Contact Map
1oi6A	2	0.8533	4.2	0.93	Contact Map
2e29A	1	0.56	4.1	0.931	Contact Map
3sriA	1	0.96	3.9	0.932	Contact Map
4fbnA	1	0.5067	3.6	0.933	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.