FAST_2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FAST_2 - FAST kinase-like protein, subdomain 2

PFAM:	PF08368	Sequences: RKKLLQLNATVCLECPEYKGPRLPPKYCQKSFLKPLSSLEKKSPLQKEVKEALKELLGGRNYVKSSVLTPYGYTIDFEVVLDKEGKPLP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	89 (88)
Sequences:	523 (301)
Seq/√Len:	32.1
META:	0.044

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
78_E	81_L	3.752	1.00
8_N	22_R	3.351	1.00
69_T	75_I	2.586	1.00
38_S	74_T	2.561	1.00
67_V	75_I	2.236	0.99
43_S	46_Q	2.096	0.98
62_Y	65_S	2.062	0.98
12_C	22_R	2.053	0.98
57_L	61_N	2.039	0.98
82_D	86_K	2.004	0.98
6_Q	73_Y	1.920	0.97
20_G	23_L	1.908	0.97
3_K	7_L	1.889	0.97
8_N	12_C	1.845	0.96
60_R	83_K	1.811	0.96
8_N	69_T	1.757	0.95
11_V	22_R	1.673	0.93
4_L	78_E	1.515	0.89
14_E	70_P	1.494	0.89
7_L	52_A	1.476	0.88
14_E	77_F	1.475	0.88
18_Y	23_L	1.451	0.87
16_P	71_Y	1.396	0.85
18_Y	21_P	1.361	0.83
31_S	39_L	1.316	0.81
84_E	87_P	1.296	0.80
69_T	73_Y	1.294	0.80
49_V	63_V	1.278	0.79
63_V	82_D	1.278	0.79
4_L	13_L	1.262	0.79
2_K	47_K	1.192	0.74
13_L	71_Y	1.169	0.73
8_N	28_C	1.169	0.73
56_L	63_V	1.115	0.69
33_L	72_G	1.100	0.68
26_K	52_A	1.085	0.67
29_Q	56_L	1.065	0.66
24_P	28_C	1.064	0.66
13_L	83_K	1.040	0.64
36_L	39_L	1.030	0.63
3_K	6_Q	1.019	0.62
20_G	66_S	1.018	0.62
54_K	59_G	1.006	0.61
48_E	87_P	1.005	0.61
75_I	86_K	1.000	0.61
14_E	71_Y	0.980	0.59
58_G	68_L	0.960	0.58
29_Q	37_S	0.932	0.55
18_Y	22_R	0.930	0.55
45_L	49_V	0.929	0.55
47_K	61_N	0.926	0.55
20_G	85_G	0.919	0.54
15_C	58_G	0.906	0.53
6_Q	10_T	0.905	0.53
2_K	43_S	0.905	0.53
23_L	77_F	0.904	0.53
63_V	87_P	0.903	0.53
6_Q	9_A	0.902	0.53
49_V	70_P	0.899	0.53
31_S	35_P	0.894	0.52
14_E	58_G	0.846	0.48
17_E	22_R	0.843	0.48
21_P	75_I	0.836	0.47
52_A	87_P	0.814	0.46
37_S	55_E	0.814	0.46
4_L	31_S	0.812	0.45
46_Q	69_T	0.808	0.45
54_K	61_N	0.807	0.45
74_T	81_L	0.802	0.45
45_L	81_L	0.796	0.44
45_L	48_E	0.785	0.43
23_L	71_Y	0.774	0.42
38_S	78_E	0.771	0.42
15_C	61_N	0.767	0.42
71_Y	77_F	0.760	0.41
61_N	66_S	0.753	0.41
80_V	85_G	0.751	0.40
64_K	80_V	0.732	0.39
80_V	87_P	0.731	0.39
5_L	15_C	0.723	0.38
9_A	17_E	0.715	0.38
18_Y	88_L	0.712	0.37
67_V	78_E	0.710	0.37
25_P	51_E	0.691	0.36
7_L	20_G	0.687	0.36
10_T	13_L	0.680	0.35
20_G	24_P	0.678	0.35
33_L	37_S	0.673	0.34
10_T	14_E	0.672	0.34
9_A	13_L	0.671	0.34
22_R	69_T	0.669	0.34
34_K	55_E	0.665	0.34
24_P	54_K	0.655	0.33
25_P	72_G	0.649	0.33
64_K	70_P	0.639	0.32
35_P	56_L	0.635	0.32
19_K	50_K	0.633	0.32
21_P	57_L	0.629	0.31
53_L	81_L	0.628	0.31
14_E	73_Y	0.621	0.31
13_L	73_Y	0.619	0.31
53_L	82_D	0.619	0.31
30_K	67_V	0.619	0.31
19_K	35_P	0.615	0.30
54_K	60_R	0.614	0.30
50_K	66_S	0.608	0.30
6_Q	66_S	0.599	0.29
79_V	88_L	0.592	0.29
19_K	51_E	0.577	0.28
31_S	44_P	0.577	0.28
34_K	61_N	0.569	0.27
12_C	86_K	0.568	0.27
31_S	54_K	0.567	0.27
6_Q	58_G	0.556	0.26
49_V	72_G	0.551	0.26
59_G	82_D	0.551	0.26
46_Q	71_Y	0.547	0.26
62_Y	68_L	0.542	0.26
55_E	68_L	0.538	0.25
64_K	87_P	0.535	0.25
9_A	73_Y	0.527	0.25
7_L	83_K	0.518	0.24
49_V	79_V	0.514	0.24
41_K	75_I	0.509	0.23
51_E	82_D	0.509	0.23
73_Y	77_F	0.507	0.23
15_C	18_Y	0.505	0.23
41_K	79_V	0.503	0.23
61_N	84_E	0.502	0.23
63_V	79_V	0.501	0.23
29_Q	87_P	0.500	0.23
46_Q	75_I	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3icfA	2	0.7079	21	0.881	Contact Map
3h63A	1	0.7978	19.3	0.883	Contact Map
1iooA	1	0.8652	18.5	0.884	Contact Map
1iqqA	1	0.8876	13.7	0.89	Contact Map
1ucdA	1	0.8764	12.2	0.892	Contact Map
2vldA	2	0.7528	10.5	0.896	Contact Map
1sglA	1	0.8539	9.8	0.897	Contact Map
1jy5A	1	0.8427	9.8	0.897	Contact Map
1vczA	1	0.9551	8.9	0.899	Contact Map
1iybA	2	0.8764	6.7	0.904	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.