YscJ_FliF_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YscJ_FliF_C - Flagellar M-ring protein C-terminal

PFAM:	PF08345	Sequences: LEPVVGPGNVRVQVSADLDFDQVEQTEETYDPDGGVVRSEQTSEESSSGAGAGGVPGALSNLPPGAAAAGAGGGSSSSRTEETTNYEVSKTVRHTVRAPGRIKRLSVAVLVDGRTYTPRSPEELAQIEALVKSAVGFDAARGDQVTVVNMPF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	152 (152)
Sequences:	18140 (12851)
Seq/√Len:	1042.4
META:	0.858

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_E	90_K	3.902	1.00
9_N	112_D	3.148	1.00
24_E	94_H	2.897	1.00
128_E	132_K	2.622	1.00
22_Q	96_V	2.441	1.00
17_D	103_K	2.404	1.00
125_A	128_E	2.371	1.00
121_P	125_A	2.331	1.00
107_V	135_V	2.252	1.00
40_E	84_T	2.168	1.00
38_R	87_E	2.041	1.00
132_K	137_F	1.948	1.00
133_S	144_Q	1.943	1.00
25_Q	93_R	1.914	1.00
37_V	84_T	1.867	1.00
2_E	10_V	1.839	1.00
42_T	82_E	1.837	1.00
109_V	131_V	1.829	1.00
26_T	94_H	1.817	1.00
39_S	85_N	1.805	1.00
26_T	92_V	1.799	1.00
27_E	91_T	1.787	1.00
31_D	89_S	1.699	1.00
43_S	81_E	1.671	1.00
23_V	95_T	1.626	1.00
21_D	97_R	1.598	1.00
41_Q	83_T	1.589	1.00
120_S	123_E	1.568	1.00
125_A	129_A	1.560	1.00
119_R	123_E	1.559	1.00
27_E	93_R	1.536	1.00
122_E	126_Q	1.511	1.00
19_D	103_K	1.500	1.00
38_R	88_V	1.480	1.00
44_E	80_T	1.475	1.00
23_V	97_R	1.461	1.00
25_Q	97_R	1.459	1.00
24_E	96_V	1.458	1.00
21_D	98_A	1.457	1.00
23_V	93_R	1.435	1.00
29_T	93_R	1.405	1.00
28_E	92_V	1.399	1.00
48_S	76_S	1.396	1.00
123_E	126_Q	1.382	1.00
30_Y	88_V	1.366	1.00
36_V	88_V	1.358	1.00
129_A	146_T	1.353	1.00
30_Y	38_R	1.319	1.00
41_Q	81_E	1.307	1.00
126_Q	148_V	1.301	1.00
129_A	148_V	1.283	1.00
14_V	107_V	1.281	1.00
129_A	132_K	1.272	1.00
45_E	79_R	1.251	1.00
17_D	104_R	1.247	1.00
127_I	147_V	1.241	1.00
137_F	145_V	1.239	1.00
16_A	105_L	1.223	1.00
133_S	146_T	1.213	1.00
40_E	82_E	1.210	1.00
30_Y	87_E	1.192	1.00
29_T	91_T	1.191	1.00
25_Q	91_T	1.178	1.00
37_V	40_E	1.169	1.00
110_L	130_L	1.144	1.00
31_D	34_G	1.142	1.00
27_E	95_T	1.137	1.00
132_K	139_A	1.129	1.00
2_E	8_G	1.122	1.00
121_P	124_L	1.116	1.00
22_Q	98_A	1.116	1.00
2_E	7_P	1.107	1.00
129_A	133_S	1.105	1.00
45_E	48_S	1.094	1.00
21_D	95_T	1.082	1.00
43_S	79_R	1.082	1.00
97_R	101_R	1.079	1.00
104_R	138_D	1.071	1.00
119_R	149_N	1.068	1.00
4_V	110_L	1.066	1.00
3_P	11_R	1.059	1.00
46_S	78_S	1.058	1.00
38_R	85_N	1.056	1.00
56_P	59_L	1.051	1.00
128_E	146_T	1.050	1.00
47_S	77_S	1.048	1.00
57_G	60_S	1.044	1.00
5_V	10_V	1.035	1.00
29_T	89_S	1.018	1.00
59_L	62_L	1.010	1.00
124_L	128_E	1.001	1.00
5_V	127_I	0.999	1.00
42_T	84_T	0.962	1.00
119_R	127_I	0.960	1.00
31_D	35_G	0.945	1.00
32_P	89_S	0.944	1.00
119_R	124_L	0.933	1.00
12_V	16_A	0.925	1.00
122_E	125_A	0.913	1.00
58_A	62_L	0.910	1.00
16_A	102_I	0.905	1.00
116_Y	151_P	0.886	1.00
116_Y	149_N	0.880	1.00
132_K	145_V	0.870	1.00
126_Q	129_A	0.870	1.00
3_P	10_V	0.866	1.00
30_Y	89_S	0.866	1.00
34_G	89_S	0.866	1.00
25_Q	95_T	0.862	1.00
117_T	120_S	0.856	1.00
22_Q	99_P	0.839	1.00
39_S	83_T	0.830	1.00
33_D	36_V	0.828	1.00
58_A	61_N	0.820	1.00
104_R	141_R	0.814	1.00
19_D	101_R	0.813	1.00
106_S	133_S	0.808	1.00
45_E	49_G	0.804	1.00
31_D	36_V	0.803	1.00
56_P	60_S	0.791	1.00
124_L	149_N	0.788	1.00
117_T	123_E	0.781	1.00
20_F	99_P	0.776	1.00
87_E	90_K	0.761	1.00
1_L	5_V	0.760	1.00
105_L	135_V	0.754	1.00
138_D	142_G	0.748	1.00
137_F	141_R	0.747	1.00
138_D	141_R	0.746	1.00
111_V	127_I	0.744	1.00
18_L	102_I	0.741	1.00
56_P	61_N	0.738	1.00
29_T	34_G	0.736	1.00
44_E	79_R	0.732	1.00
119_R	122_E	0.726	1.00
112_D	149_N	0.724	1.00
55_V	60_S	0.717	1.00
65_G	68_A	0.717	1.00
32_P	35_G	0.710	1.00
67_A	70_G	0.705	1.00
35_G	88_V	0.705	1.00
45_E	77_S	0.703	1.00
66_A	70_G	0.702	1.00
54_G	60_S	0.701	1.00
37_V	86_Y	0.699	1.00
108_A	130_L	0.699	1.00
54_G	57_G	0.694	1.00
66_A	69_A	0.689	1.00
42_T	80_T	0.681	1.00
44_E	78_S	0.676	1.00
71_A	74_G	0.673	1.00
131_V	145_V	0.672	1.00
46_S	76_S	0.672	1.00
46_S	49_G	0.670	1.00
126_Q	150_M	0.656	1.00
68_A	71_A	0.653	1.00
30_Y	90_K	0.653	1.00
104_R	144_Q	0.649	1.00
60_S	63_P	0.647	1.00
139_A	144_Q	0.645	1.00
116_Y	119_R	0.636	1.00
65_G	69_A	0.635	1.00
55_V	58_A	0.630	1.00
128_E	147_V	0.629	1.00
70_G	73_G	0.623	1.00
132_K	135_V	0.620	1.00
53_G	56_P	0.617	1.00
10_V	13_Q	0.608	1.00
105_L	145_V	0.604	1.00
114_R	117_T	0.600	1.00
32_P	36_V	0.591	1.00
106_S	144_Q	0.591	1.00
105_L	141_R	0.591	1.00
10_V	109_V	0.588	1.00
44_E	47_S	0.587	1.00
115_T	118_P	0.587	1.00
4_V	127_I	0.585	1.00
128_E	145_V	0.583	1.00
112_D	116_Y	0.581	1.00
108_A	133_S	0.579	1.00
15_S	106_S	0.578	1.00
4_V	150_M	0.577	1.00
67_A	71_A	0.573	1.00
72_G	75_S	0.571	1.00
47_S	76_S	0.570	1.00
19_D	97_R	0.567	1.00
64_P	67_A	0.566	1.00
103_K	107_V	0.566	1.00
68_A	72_G	0.564	1.00
47_S	75_S	0.562	1.00
71_A	75_S	0.561	1.00
121_P	128_E	0.561	1.00
5_V	9_N	0.557	1.00
116_Y	120_S	0.554	1.00
112_D	152_F	0.554	1.00
53_G	57_G	0.553	1.00
105_L	108_A	0.551	1.00
36_V	89_S	0.549	1.00
107_V	137_F	0.549	1.00
118_P	149_N	0.545	1.00
64_P	69_A	0.543	1.00
14_V	17_D	0.539	1.00
111_V	119_R	0.534	1.00
106_S	109_V	0.530	1.00
113_G	116_Y	0.530	1.00
59_L	63_P	0.529	1.00
107_V	131_V	0.529	1.00
45_E	78_S	0.526	1.00
3_P	7_P	0.523	1.00
135_V	145_V	0.522	1.00
102_I	105_L	0.520	1.00
64_P	71_A	0.518	1.00
3_P	13_Q	0.517	1.00
51_G	54_G	0.515	1.00
56_P	63_P	0.514	1.00
64_P	68_A	0.513	1.00
17_D	138_D	0.511	1.00
69_A	72_G	0.510	1.00
118_P	151_P	0.510	1.00
18_L	103_K	0.508	1.00
32_P	88_V	0.508	1.00
110_L	150_M	0.507	1.00
24_E	92_V	0.506	1.00
148_V	151_P	0.506	1.00
70_G	74_G	0.505	1.00
124_L	147_V	0.503	1.00
130_L	146_T	0.500	1.00
57_G	61_N	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4oycA	1	0.4803	15.2	0.91	Contact Map
3tufA	2	0.7171	14.1	0.911	Contact Map
4okrA	1	0.3553	5	0.928	Contact Map
2odpA	1	0.3618	4.8	0.928	Contact Map
4hqfA	1	0.3421	3.7	0.932	Contact Map
4icvA	1	0.3618	3.6	0.933	Contact Map
3tvyA	1	0.3092	3.4	0.933	Contact Map
3sxxA	5	0.2763	3.1	0.935	Contact Map
4hqoA	1	0.4079	2.8	0.936	Contact Map
1yj7A	3	0.9013	2.5	0.938	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.