PIG-X - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PIG-X - PIG-X / PBN1

PFAM:	PF08320	Sequences: PTGFHRTLLTSVELGSSIEDLSPSSCALHAYLTLPSGVFVDPYELASLDRRALVAVSGETDLEAPEYLSKQWGSEVLLELAPSDPQCSSEWTVELPLHLRYHRPSSEESGYATVELPWPDVFWACDDSAEEGTKFVENPFDRVNLGYDGLFGPRTQFYHLPPKPASGELVLTLQVPVGDLSHSSLVEAGTLLVTLLGFLWILWALF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	206 (202)
Sequences:	594 (462)
Seq/√Len:	32.5
META:	0.148

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
26_C	125_C	11.358	1.00
43_Y	62_L	5.173	1.00
99_L	175_V	4.383	1.00
40_V	76_V	3.967	1.00
10_T	32_L	3.923	1.00
34_L	38_V	3.058	1.00
36_S	66_E	3.044	1.00
118_W	171_L	2.669	1.00
102_H	177_V	2.596	1.00
36_S	58_G	2.537	1.00
105_S	109_S	2.399	0.99
96_P	176_P	2.375	0.99
61_D	64_A	2.358	0.99
39_F	42_P	2.343	0.99
58_G	62_L	2.207	0.99
12_V	15_G	2.168	0.99
45_L	96_P	2.161	0.99
41_D	62_L	2.104	0.98
3_G	6_R	2.050	0.98
3_G	8_L	2.012	0.98
38_V	116_L	1.864	0.96
67_Y	104_P	1.794	0.96
134_K	152_G	1.734	0.95
179_D	182_H	1.717	0.94
39_F	62_L	1.704	0.94
102_H	155_T	1.704	0.94
55_A	58_G	1.691	0.94
98_H	101_Y	1.611	0.92
29_H	122_F	1.606	0.92
62_L	72_W	1.572	0.91
133_T	154_R	1.530	0.90
56_V	108_E	1.512	0.90
65_P	104_P	1.497	0.89
21_L	181_S	1.495	0.89
12_V	167_G	1.478	0.88
42_P	56_V	1.418	0.86
36_S	60_T	1.401	0.86
195_L	202_L	1.396	0.85
5_H	101_Y	1.390	0.85
66_E	69_S	1.389	0.85
138_N	141_D	1.388	0.85
62_L	65_P	1.357	0.84
118_W	162_P	1.322	0.82
57_S	62_L	1.297	0.81
83_S	86_Q	1.293	0.81
12_V	160_L	1.282	0.80
5_H	8_L	1.282	0.80
147_Y	159_H	1.277	0.80
44_E	96_P	1.255	0.79
133_T	152_G	1.251	0.78
44_E	99_L	1.246	0.78
29_H	69_S	1.238	0.78
37_G	112_A	1.223	0.77
197_G	201_I	1.222	0.77
37_G	69_S	1.219	0.76
106_S	109_S	1.216	0.76
132_G	156_Q	1.189	0.75
37_G	114_V	1.187	0.75
88_S	113_T	1.184	0.74
6_R	194_T	1.180	0.74
122_F	140_F	1.174	0.74
96_P	177_V	1.161	0.73
38_V	46_A	1.159	0.73
177_V	194_T	1.158	0.73
44_E	48_L	1.151	0.72
9_L	197_G	1.140	0.71
71_Q	108_E	1.134	0.71
56_V	163_K	1.134	0.71
50_R	70_K	1.124	0.70
45_L	78_L	1.117	0.70
5_H	98_H	1.113	0.70
84_D	168_E	1.107	0.69
129_A	149_G	1.106	0.69
31_Y	34_L	1.097	0.68
42_P	62_L	1.091	0.68
113_T	174_Q	1.090	0.68
9_L	94_E	1.089	0.68
10_T	41_D	1.087	0.68
6_R	69_S	1.061	0.66
191_L	194_T	1.056	0.65
9_L	92_T	1.049	0.65
47_S	61_D	1.048	0.65
165_A	188_A	1.046	0.65
26_C	35_P	1.038	0.64
30_A	82_P	1.034	0.64
104_P	173_L	1.024	0.63
134_K	137_E	1.018	0.63
6_R	10_T	1.014	0.62
38_V	99_L	1.011	0.62
44_E	72_W	1.007	0.62
69_S	194_T	1.004	0.61
36_S	187_E	0.993	0.61
44_E	61_D	0.986	0.60
40_V	45_L	0.986	0.60
107_E	181_S	0.984	0.60
6_R	74_S	0.982	0.60
16_S	19_E	0.981	0.60
78_L	106_S	0.979	0.59
108_E	180_L	0.968	0.59
163_K	166_S	0.966	0.58
88_S	202_L	0.961	0.58
32_L	57_S	0.960	0.58
6_R	39_F	0.959	0.58
39_F	201_I	0.941	0.56
68_L	174_Q	0.935	0.56
63_E	100_R	0.931	0.56
140_F	157_F	0.928	0.55
173_L	186_V	0.925	0.55
85_P	90_E	0.923	0.55
73_G	124_A	0.923	0.55
187_E	194_T	0.915	0.54
40_V	55_A	0.905	0.53
128_S	160_L	0.895	0.53
62_L	122_F	0.894	0.53
37_G	44_E	0.889	0.52
104_P	192_L	0.878	0.51
149_G	152_G	0.878	0.51
121_V	124_A	0.876	0.51
17_S	20_D	0.875	0.51
109_S	164_P	0.875	0.51
64_A	67_Y	0.872	0.51
185_L	196_L	0.871	0.51
63_E	101_Y	0.865	0.50
188_A	195_L	0.862	0.50
39_F	72_W	0.861	0.50
47_S	50_R	0.860	0.50
90_E	199_L	0.851	0.49
7_T	94_E	0.850	0.49
114_V	144_N	0.830	0.47
152_G	156_Q	0.815	0.46
108_E	196_L	0.812	0.46
102_H	178_G	0.804	0.45
132_G	154_R	0.804	0.45
6_R	178_G	0.803	0.45
160_L	165_A	0.801	0.45
187_E	197_G	0.800	0.45
123_W	194_T	0.799	0.45
42_P	68_L	0.792	0.44
40_V	56_V	0.791	0.44
50_R	102_H	0.789	0.44
145_L	153_P	0.788	0.44
69_S	74_S	0.785	0.44
31_Y	38_V	0.784	0.44
178_G	182_H	0.781	0.43
74_S	77_L	0.781	0.43
68_L	173_L	0.777	0.43
92_T	116_L	0.775	0.43
95_L	198_F	0.772	0.43
41_D	65_P	0.770	0.42
60_T	102_H	0.769	0.42
86_Q	192_L	0.767	0.42
38_V	113_T	0.761	0.42
61_D	65_P	0.761	0.42
93_V	204_A	0.760	0.42
6_R	29_H	0.760	0.42
137_E	142_R	0.758	0.41
157_F	192_L	0.751	0.41
95_L	176_P	0.750	0.41
8_L	64_A	0.749	0.41
97_L	117_P	0.748	0.41
137_E	141_D	0.747	0.41
138_N	181_S	0.745	0.40
4_F	96_P	0.745	0.40
85_P	168_E	0.744	0.40
58_G	93_V	0.742	0.40
124_A	155_T	0.741	0.40
9_L	44_E	0.738	0.40
41_D	77_L	0.738	0.40
3_G	122_F	0.736	0.40
62_L	157_F	0.735	0.40
11_S	185_L	0.734	0.40
55_A	121_V	0.731	0.39
195_L	199_L	0.730	0.39
172_T	193_V	0.729	0.39
12_V	84_D	0.729	0.39
43_Y	123_W	0.728	0.39
112_A	175_V	0.727	0.39
69_S	178_G	0.723	0.39
21_L	160_L	0.722	0.39
166_S	169_L	0.720	0.38
109_S	179_D	0.719	0.38
117_P	121_V	0.716	0.38
142_R	145_L	0.715	0.38
80_L	109_S	0.713	0.38
182_H	185_L	0.709	0.38
117_P	123_W	0.709	0.38
12_V	166_S	0.708	0.37
26_C	200_W	0.708	0.37
101_Y	176_P	0.708	0.37
3_G	42_P	0.705	0.37
35_P	187_E	0.704	0.37
112_A	180_L	0.699	0.37
140_F	155_T	0.696	0.37
29_H	32_L	0.695	0.36
120_D	143_V	0.695	0.36
165_A	168_E	0.693	0.36
142_R	197_G	0.693	0.36
99_L	117_P	0.693	0.36
48_L	52_A	0.686	0.36
30_A	44_E	0.686	0.36
96_P	125_C	0.685	0.36
36_S	171_L	0.684	0.36
128_S	180_L	0.681	0.35
6_R	32_L	0.679	0.35
85_P	169_L	0.674	0.35
40_V	172_T	0.672	0.35
29_H	201_I	0.671	0.35
200_W	204_A	0.670	0.35
138_N	155_T	0.669	0.35
2_T	6_R	0.668	0.34
18_I	114_V	0.666	0.34
144_N	152_G	0.666	0.34
63_E	98_H	0.662	0.34
21_L	134_K	0.654	0.33
3_G	139_P	0.652	0.33
89_S	112_A	0.651	0.33
54_V	108_E	0.650	0.33
110_G	117_P	0.650	0.33
187_E	191_L	0.648	0.33
38_V	62_L	0.647	0.33
44_E	119_P	0.646	0.33
2_T	178_G	0.645	0.33
168_E	195_L	0.640	0.32
84_D	192_L	0.638	0.32
157_F	162_P	0.633	0.32
96_P	198_F	0.630	0.32
6_R	72_W	0.628	0.32
173_L	187_E	0.623	0.31
58_G	99_L	0.619	0.31
79_E	157_F	0.617	0.31
54_V	203_W	0.616	0.31
5_H	176_P	0.615	0.31
55_A	77_L	0.614	0.31
151_F	157_F	0.610	0.30
86_Q	168_E	0.605	0.30
89_S	115_E	0.601	0.30
59_E	71_Q	0.601	0.30
63_E	176_P	0.599	0.29
2_T	107_E	0.599	0.29
73_G	139_P	0.599	0.29
38_V	97_L	0.598	0.29
122_F	151_F	0.597	0.29
172_T	180_L	0.595	0.29
128_S	137_E	0.595	0.29
44_E	79_E	0.594	0.29
39_F	76_V	0.589	0.29
43_Y	74_S	0.589	0.29
78_L	169_L	0.586	0.29
84_D	87_C	0.584	0.28
6_R	140_F	0.582	0.28
28_L	199_L	0.579	0.28
94_E	102_H	0.579	0.28
43_Y	89_S	0.577	0.28
61_D	67_Y	0.577	0.28
6_R	26_C	0.575	0.28
149_G	154_R	0.574	0.28
39_F	69_S	0.566	0.27
62_L	69_S	0.565	0.27
43_Y	77_L	0.562	0.27
12_V	111_Y	0.560	0.27
11_S	97_L	0.560	0.27
105_S	186_V	0.560	0.27
85_P	172_T	0.559	0.27
140_F	146_G	0.559	0.27
64_A	68_L	0.556	0.27
147_Y	151_F	0.552	0.26
84_D	169_L	0.549	0.26
96_P	196_L	0.548	0.26
161_P	172_T	0.548	0.26
60_T	66_E	0.546	0.26
135_F	171_L	0.545	0.26
84_D	89_S	0.544	0.26
132_G	152_G	0.544	0.26
32_L	66_E	0.543	0.26
11_S	189_G	0.542	0.26
70_K	201_I	0.542	0.26
5_H	100_R	0.541	0.26
138_N	157_F	0.540	0.26
24_S	189_G	0.535	0.25
144_N	149_G	0.532	0.25
39_F	65_P	0.532	0.25
95_L	174_Q	0.530	0.25
75_E	78_L	0.529	0.25
24_S	165_A	0.529	0.25
85_P	130_E	0.528	0.25
112_A	172_T	0.527	0.25
38_V	114_V	0.527	0.25
73_G	123_W	0.526	0.25
8_L	173_L	0.525	0.25
15_G	23_P	0.524	0.25
56_V	191_L	0.523	0.25
175_V	200_W	0.519	0.24
135_F	140_F	0.519	0.24
81_A	175_V	0.516	0.24
123_W	158_Y	0.514	0.24
164_P	189_G	0.512	0.24
83_S	87_C	0.512	0.24
121_V	146_G	0.511	0.24
39_F	194_T	0.508	0.24
8_L	87_C	0.503	0.23
29_H	44_E	0.501	0.23
31_Y	137_E	0.501	0.23
62_L	104_P	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1qleD	1	0.199	7.8	0.946	Contact Map
2micA	2	0.1553	7.7	0.946	Contact Map
1m56D	1	0.1942	6.3	0.948	Contact Map
1edyA	2	0.5728	3.9	0.953	Contact Map
1ayoA	2	0.5534	3.7	0.954	Contact Map
4gwpB	1	0.2476	3.2	0.955	Contact Map
2m59A	2	0.1214	2.6	0.957	Contact Map
4h62Q	1	0.2718	2.5	0.958	Contact Map
2zxxC	1	0.2864	2.5	0.958	Contact Map
2k9pA	1	0.1796	2.4	0.958	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.