NGP1NT - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

NGP1NT - NGP1NT (NUC091) domain

PFAM:	PF08153	Sequences: MYKNGKAKRNKKGKIIKAAPFQSREAPVARIEPDRRWFGNTRVISQKALQKFREEMGEKAKDPYSVLLKRNKLPMSLLQDKAKKARVHLLETEPFEDTFGPKAQRKRPKLAVSSLEELAKKAEKSQDTY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	129 (129)
Sequences:	637 (404)
Seq/√Len:	35.5
META:	0.344

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
10_N	14_K	3.950	1.00
9_R	15_I	3.456	1.00
114_S	117_E	2.994	1.00
100_G	103_A	2.740	1.00
88_H	91_E	2.739	1.00
120_K	124_K	2.559	1.00
112_V	118_L	2.249	0.99
47_K	50_Q	2.130	0.99
8_K	11_K	2.108	0.99
101_P	104_Q	2.089	0.99
32_E	36_R	2.069	0.99
4_N	20_P	2.050	0.99
97_D	104_Q	1.987	0.98
18_A	21_F	1.978	0.98
44_I	76_S	1.936	0.98
119_A	123_E	1.915	0.98
27_P	67_L	1.867	0.97
45_S	48_A	1.838	0.97
41_T	70_R	1.766	0.96
90_L	94_P	1.722	0.96
115_L	119_A	1.652	0.95
122_A	125_S	1.642	0.94
8_K	16_I	1.588	0.93
17_K	76_S	1.587	0.93
18_A	22_Q	1.559	0.93
74_P	77_L	1.544	0.92
92_T	112_V	1.540	0.92
29_A	50_Q	1.538	0.92
56_M	59_K	1.512	0.92
100_G	105_R	1.507	0.91
94_P	97_D	1.502	0.91
113_S	117_E	1.445	0.90
17_K	21_F	1.440	0.89
48_A	64_Y	1.439	0.89
47_K	71_N	1.430	0.89
51_K	55_E	1.415	0.89
75_M	80_D	1.389	0.88
56_M	78_L	1.367	0.87
27_P	31_I	1.358	0.86
125_S	128_T	1.354	0.86
34_D	39_G	1.329	0.85
121_K	124_K	1.318	0.85
24_R	109_K	1.314	0.85
65_S	78_L	1.299	0.84
118_L	122_A	1.298	0.84
62_D	65_S	1.288	0.83
124_K	128_T	1.239	0.81
12_K	16_I	1.213	0.79
100_G	110_L	1.209	0.79
52_F	62_D	1.191	0.78
17_K	20_P	1.172	0.77
19_A	65_S	1.157	0.76
33_P	37_W	1.155	0.76
88_H	92_T	1.127	0.74
57_G	65_S	1.126	0.74
16_I	89_L	1.096	0.72
57_G	96_E	1.082	0.71
71_N	75_M	1.079	0.71
83_K	87_V	1.075	0.70
53_R	59_K	1.062	0.70
43_V	73_L	1.048	0.69
15_I	55_E	1.045	0.68
5_G	75_M	1.045	0.68
19_A	22_Q	1.041	0.68
52_F	80_D	1.032	0.67
29_A	33_P	1.025	0.67
103_A	110_L	1.008	0.65
60_A	78_L	1.006	0.65
17_K	69_K	1.004	0.65
43_V	52_F	0.998	0.65
83_K	104_Q	0.982	0.63
25_E	28_V	0.982	0.63
15_I	22_Q	0.976	0.63
44_I	101_P	0.965	0.62
31_I	48_A	0.958	0.61
35_R	109_K	0.945	0.60
120_K	123_E	0.920	0.58
35_R	68_L	0.913	0.58
6_K	63_P	0.912	0.58
56_M	117_E	0.908	0.57
93_E	108_P	0.904	0.57
97_D	100_G	0.898	0.56
62_D	126_Q	0.888	0.56
122_A	126_Q	0.883	0.55
32_E	63_P	0.877	0.55
65_S	116_E	0.873	0.54
52_F	106_K	0.871	0.54
98_T	128_T	0.870	0.54
39_G	66_V	0.863	0.53
89_L	94_P	0.853	0.53
39_G	98_T	0.842	0.52
107_R	126_Q	0.840	0.51
43_V	57_G	0.836	0.51
50_Q	53_R	0.830	0.51
108_P	111_A	0.808	0.49
81_K	114_S	0.803	0.48
64_Y	67_L	0.797	0.48
117_E	126_Q	0.797	0.48
57_G	124_K	0.780	0.46
48_A	52_F	0.767	0.45
5_G	10_N	0.766	0.45
57_G	60_A	0.756	0.44
36_R	39_G	0.755	0.44
51_K	93_E	0.755	0.44
68_L	87_V	0.744	0.43
29_A	48_A	0.733	0.42
50_Q	81_K	0.731	0.42
78_L	83_K	0.729	0.42
85_A	95_F	0.729	0.42
83_K	88_H	0.728	0.42
20_P	23_S	0.728	0.42
60_A	94_P	0.726	0.42
123_E	128_T	0.716	0.41
53_R	67_L	0.716	0.41
6_K	101_P	0.713	0.41
4_N	8_K	0.712	0.41
8_K	17_K	0.705	0.40
118_L	124_K	0.702	0.40
45_S	75_M	0.694	0.39
17_K	115_L	0.692	0.39
50_Q	89_L	0.675	0.37
116_E	124_K	0.670	0.37
100_G	104_Q	0.665	0.37
85_A	89_L	0.664	0.37
90_L	96_E	0.662	0.36
12_K	17_K	0.662	0.36
41_T	98_T	0.661	0.36
57_G	97_D	0.659	0.36
19_A	73_L	0.654	0.36
49_L	91_E	0.652	0.36
98_T	103_A	0.648	0.35
21_F	27_P	0.648	0.35
1_M	64_Y	0.644	0.35
14_K	116_E	0.639	0.35
44_I	119_A	0.638	0.35
119_A	122_A	0.638	0.35
55_E	64_Y	0.634	0.34
102_K	106_K	0.628	0.34
96_E	121_K	0.627	0.34
4_N	69_K	0.626	0.34
5_G	16_I	0.624	0.33
42_R	75_M	0.624	0.33
26_A	29_A	0.622	0.33
56_M	65_S	0.616	0.33
6_K	45_S	0.613	0.33
111_A	125_S	0.610	0.32
12_K	102_K	0.607	0.32
34_D	42_R	0.606	0.32
44_I	127_D	0.605	0.32
2_Y	50_Q	0.602	0.32
25_E	94_P	0.591	0.31
44_I	110_L	0.587	0.31
53_R	77_L	0.585	0.31
88_H	93_E	0.585	0.31
5_G	20_P	0.584	0.30
58_E	101_P	0.584	0.30
117_E	120_K	0.581	0.30
20_P	90_L	0.579	0.30
79_Q	87_V	0.575	0.30
53_R	71_N	0.572	0.30
31_I	109_K	0.571	0.30
56_M	66_V	0.569	0.29
109_K	114_S	0.569	0.29
3_K	9_R	0.566	0.29
48_A	51_K	0.565	0.29
90_L	115_L	0.562	0.29
62_D	72_K	0.562	0.29
23_S	26_A	0.560	0.29
87_V	90_L	0.556	0.28
75_M	113_S	0.555	0.28
78_L	87_V	0.553	0.28
117_E	121_K	0.552	0.28
116_E	120_K	0.551	0.28
89_L	103_A	0.548	0.28
62_D	70_R	0.543	0.28
68_L	111_A	0.537	0.27
36_R	58_E	0.534	0.27
2_Y	21_F	0.533	0.27
22_Q	32_E	0.527	0.26
46_Q	103_A	0.522	0.26
53_R	75_M	0.518	0.26
113_S	119_A	0.517	0.26
22_Q	76_S	0.514	0.26
2_Y	83_K	0.513	0.26
28_V	67_L	0.510	0.25
80_D	116_E	0.509	0.25
3_K	96_E	0.508	0.25
79_Q	111_A	0.507	0.25
43_V	48_A	0.507	0.25
93_E	97_D	0.506	0.25
111_A	117_E	0.504	0.25
41_T	69_K	0.502	0.25
8_K	21_F	0.501	0.25
41_T	58_E	0.500	0.25

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1b7yB	2	0.4651	9.8	0.951	Contact Map
3u24A	1	0.6357	8	0.953	Contact Map
3pcoB	2	0.5194	7	0.954	Contact Map
1b69A	1	0.4264	5.2	0.957	Contact Map
3qdlA	4	0.3333	4.6	0.958	Contact Map
1z1bA	3	0.9535	4.3	0.958	Contact Map
1yu8X	1	0.3798	4.1	0.959	Contact Map
2o70A	2	0.3488	4	0.959	Contact Map
3cmqA	1	0.5116	3.9	0.959	Contact Map
3o0yA	3	0.6899	3.8	0.959	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.