BING4CT - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

BING4CT - BING4CT (NUC141) domain

PFAM:	PF08149	Sequences: PYMTHGLPGSPVESVRFCPFEDVLGVGHSKGFSSILVPGAGEPNFDALEANPFETKKQRREAEVKSLLDKLQPEMITLD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	79 (79)
Sequences:	743 (461)
Seq/√Len:	51.9
META:	0.463

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
26_V	35_I	5.536	1.00
25_G	32_F	4.777	1.00
71_L	75_M	4.467	1.00
54_E	62_A	3.670	1.00
51_N	58_Q	3.608	1.00
25_G	34_S	2.638	1.00
72_Q	75_M	2.392	1.00
3_M	37_V	2.007	1.00
20_F	49_E	1.911	0.99
20_F	50_A	1.861	0.99
57_K	60_R	1.772	0.99
27_G	31_G	1.754	0.99
28_H	31_G	1.574	0.98
10_S	30_K	1.446	0.96
20_F	45_F	1.379	0.95
18_C	24_L	1.313	0.94
25_G	33_S	1.310	0.93
5_H	35_I	1.297	0.93
23_V	36_L	1.284	0.93
11_P	29_S	1.270	0.92
18_C	25_G	1.242	0.91
18_C	23_V	1.165	0.89
56_K	60_R	1.145	0.88
12_V	15_V	1.141	0.88
18_C	32_F	1.139	0.87
47_A	51_N	1.122	0.87
5_H	27_G	1.044	0.82
59_R	63_E	1.023	0.81
7_L	12_V	1.022	0.81
55_T	58_Q	1.000	0.80
50_A	69_D	0.995	0.79
50_A	54_E	0.931	0.75
3_M	7_L	0.918	0.74
18_C	71_L	0.912	0.73
37_V	59_R	0.910	0.73
46_D	67_L	0.905	0.72
15_V	33_S	0.904	0.72
44_N	63_E	0.879	0.70
52_P	67_L	0.873	0.70
36_L	49_E	0.865	0.69
20_F	34_S	0.863	0.69
28_H	33_S	0.861	0.69
24_L	45_F	0.851	0.68
12_V	72_Q	0.847	0.67
46_D	49_E	0.825	0.65
50_A	65_K	0.823	0.65
13_E	57_K	0.810	0.64
47_A	53_F	0.808	0.64
21_E	43_P	0.777	0.61
53_F	56_K	0.777	0.61
11_P	53_F	0.767	0.60
17_F	69_D	0.751	0.58
17_F	29_S	0.743	0.57
54_E	59_R	0.739	0.57
34_S	68_L	0.733	0.56
9_G	29_S	0.727	0.56
27_G	55_T	0.727	0.56
10_S	17_F	0.720	0.55
10_S	29_S	0.716	0.54
20_F	58_Q	0.707	0.53
3_M	79_D	0.704	0.53
7_L	26_V	0.702	0.53
51_N	62_A	0.692	0.52
34_S	45_F	0.690	0.52
62_A	65_K	0.686	0.51
11_P	18_C	0.685	0.51
10_S	16_R	0.683	0.51
10_S	36_L	0.683	0.51
22_D	38_P	0.679	0.51
49_E	77_T	0.677	0.50
35_I	40_A	0.674	0.50
32_F	57_K	0.673	0.50
30_K	53_F	0.673	0.50
40_A	75_M	0.672	0.50
6_G	9_G	0.666	0.49
10_S	13_E	0.666	0.49
14_S	27_G	0.660	0.49
48_L	51_N	0.657	0.48
1_P	21_E	0.654	0.48
6_G	10_S	0.654	0.48
8_P	64_V	0.646	0.47
21_E	48_L	0.643	0.47
71_L	77_T	0.631	0.46
11_P	55_T	0.630	0.45
34_S	62_A	0.626	0.45
7_L	10_S	0.625	0.45
70_K	76_I	0.609	0.43
59_R	74_E	0.604	0.43
71_L	76_I	0.600	0.42
18_C	74_E	0.600	0.42
19_P	51_N	0.595	0.42
65_K	69_D	0.591	0.41
62_A	74_E	0.589	0.41
8_P	48_L	0.588	0.41
69_D	77_T	0.583	0.41
4_T	17_F	0.582	0.41
21_E	74_E	0.580	0.40
8_P	49_E	0.580	0.40
21_E	51_N	0.570	0.39
5_H	17_F	0.564	0.39
19_P	54_E	0.563	0.39
3_M	14_S	0.558	0.38
6_G	11_P	0.547	0.37
47_A	58_Q	0.538	0.36
28_H	66_S	0.538	0.36
4_T	8_P	0.537	0.36
27_G	69_D	0.533	0.36
18_C	72_Q	0.533	0.36
53_F	61_E	0.528	0.35
17_F	40_A	0.526	0.35
48_L	63_E	0.519	0.34
56_K	59_R	0.515	0.34
3_M	6_G	0.510	0.34
65_K	77_T	0.509	0.33
13_E	29_S	0.507	0.33
12_V	26_V	0.504	0.33
17_F	32_F	0.503	0.33
52_P	58_Q	0.500	0.33

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4n7vC	1	0.3924	20.7	0.922	Contact Map
1mukA	1	0.5823	16.1	0.925	Contact Map
1r5mA	1	0.4937	13.3	0.928	Contact Map
1g8mA	2	0.7722	13.1	0.928	Contact Map
1zczA	2	0.7848	12.7	0.929	Contact Map
3zzmA	2	0.7848	10.7	0.931	Contact Map
4ehiA	2	0.7848	10.3	0.931	Contact Map
2xxpA	1	0.8861	10.1	0.932	Contact Map
3d2mA	5	0.9494	9.3	0.933	Contact Map
4bzjA	2	0.8354	8	0.935	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.