AARP2CN - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

AARP2CN - AARP2CN (NUC121) domain

PFAM:	PF08142	Sequences: EILNLLRFISVMKPRPLRWRNSRPYLLADRVEDLTDPEDIRENPKCDRTVVLYGYVRGTPLKANRLVHIPGVGDFQISKIEALPDP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	86 (84)
Sequences:	1439 (973)
Seq/√Len:	106.2
META:	0.418

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_D	48_R	4.228	1.00
7_R	11_V	3.697	1.00
68_H	74_D	3.468	1.00
66_L	76_Q	3.173	1.00
4_N	8_F	2.344	1.00
30_R	53_Y	2.339	1.00
39_D	46_C	1.970	1.00
34_L	51_V	1.887	1.00
49_T	78_S	1.832	1.00
36_D	39_D	1.718	1.00
33_D	50_V	1.697	1.00
24_P	61_L	1.673	1.00
40_I	46_C	1.657	1.00
35_T	48_R	1.588	1.00
31_V	52_L	1.548	1.00
8_F	11_V	1.546	1.00
68_H	71_G	1.515	1.00
69_I	72_V	1.515	1.00
61_L	67_V	1.441	1.00
24_P	59_T	1.410	1.00
39_D	43_N	1.388	1.00
43_N	46_C	1.364	1.00
65_R	77_I	1.324	0.99
31_V	56_V	1.235	0.99
17_L	20_R	1.229	0.99
56_V	61_L	1.214	0.99
61_L	77_I	1.204	0.99
24_P	60_P	1.204	0.99
5_L	13_K	1.183	0.99
29_D	57_R	1.173	0.99
71_G	85_D	1.129	0.98
71_G	74_D	1.120	0.98
39_D	44_P	1.117	0.98
7_R	14_P	1.093	0.98
23_R	53_Y	1.056	0.97
4_N	7_R	1.045	0.97
46_C	84_P	1.035	0.97
53_Y	83_L	1.026	0.97
9_I	14_P	0.995	0.96
37_P	40_I	0.987	0.96
28_A	31_V	0.968	0.95
28_A	52_L	0.946	0.95
66_L	75_F	0.940	0.95
18_R	59_T	0.933	0.94
40_I	47_D	0.932	0.94
62_K	65_R	0.922	0.94
63_A	66_L	0.921	0.94
20_R	25_Y	0.918	0.94
29_D	72_V	0.902	0.93
52_L	77_I	0.898	0.93
14_P	19_W	0.896	0.93
5_L	74_D	0.868	0.92
40_I	43_N	0.863	0.92
47_D	69_I	0.858	0.91
18_R	21_N	0.855	0.91
9_I	69_I	0.849	0.91
44_P	47_D	0.838	0.91
1_E	13_K	0.837	0.90
39_D	45_K	0.828	0.90
19_W	22_S	0.826	0.90
36_D	40_I	0.813	0.89
13_K	55_Y	0.808	0.89
14_P	17_L	0.805	0.89
77_I	80_I	0.799	0.88
72_V	75_F	0.791	0.88
21_N	59_T	0.780	0.87
50_V	66_L	0.774	0.87
58_G	69_I	0.769	0.86
65_R	76_Q	0.767	0.86
26_L	70_P	0.765	0.86
22_S	57_R	0.759	0.86
3_L	7_R	0.757	0.85
24_P	55_Y	0.744	0.84
19_W	37_P	0.727	0.83
24_P	56_V	0.723	0.83
43_N	69_I	0.713	0.82
15_R	18_R	0.710	0.82
66_L	80_I	0.706	0.81
32_E	51_V	0.700	0.81
32_E	35_T	0.698	0.81
56_V	60_P	0.693	0.80
21_N	71_G	0.692	0.80
28_A	57_R	0.691	0.80
8_F	23_R	0.689	0.80
10_S	13_K	0.682	0.79
5_L	35_T	0.673	0.78
23_R	63_A	0.670	0.78
15_R	30_R	0.656	0.76
62_K	77_I	0.652	0.76
51_V	64_N	0.643	0.75
29_D	58_G	0.642	0.75
26_L	56_V	0.642	0.75
67_V	70_P	0.642	0.75
25_Y	58_G	0.635	0.74
24_P	74_D	0.634	0.74
18_R	22_S	0.633	0.74
65_R	84_P	0.632	0.74
64_N	78_S	0.630	0.73
60_P	64_N	0.628	0.73
35_T	47_D	0.627	0.73
16_P	32_E	0.626	0.73
12_M	62_K	0.624	0.73
40_I	44_P	0.623	0.73
18_R	24_P	0.618	0.72
43_N	63_A	0.611	0.71
26_L	51_V	0.608	0.71
3_L	12_M	0.598	0.69
55_Y	85_D	0.598	0.69
33_D	55_Y	0.592	0.69
67_V	77_I	0.589	0.68
55_Y	86_P	0.568	0.66
16_P	20_R	0.568	0.66
2_I	25_Y	0.560	0.64
13_K	16_P	0.546	0.62
24_P	80_I	0.545	0.62
46_C	56_V	0.543	0.62
63_A	77_I	0.542	0.62
5_L	34_L	0.541	0.62
11_V	23_R	0.538	0.61
52_L	75_F	0.537	0.61
61_L	80_I	0.518	0.58
45_K	50_V	0.516	0.58
1_E	25_Y	0.513	0.58
9_I	34_L	0.511	0.57
2_I	9_I	0.506	0.57
5_L	8_F	0.500	0.56

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4rd4A	1	0.9535	36.8	0.881	Contact Map
4tmxA	1	0.8721	34.4	0.883	Contact Map
1d2eA	3	0.8721	26.5	0.889	Contact Map
3avxA	1	0.8721	26	0.89	Contact Map
4upyB	1	0.8721	21.1	0.895	Contact Map
2c78A	1	0.8605	16.8	0.899	Contact Map
1s0uA	1	0.9651	16.5	0.899	Contact Map
3j81k	1	0.7326	15.8	0.9	Contact Map
3wbiA	1	0.8605	14.7	0.902	Contact Map
4zciA	1	0.8721	13.6	0.903	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.