SspH - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SspH - Small acid-soluble spore protein H family

PFAM:	PF08141	Sequences: MDVQRAKEILSSPEMINVTYNGVPVWIEHVDEDNGTATVHPLDNPEEEQEVPVSELEE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	58 (58)
Sequences:	1146 (817)
Seq/√Len:	107.2
META:	0.552

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_E	40_H	4.322	1.00
3_V	30_V	2.712	1.00
27_I	37_A	2.562	1.00
7_K	32_E	2.503	1.00
5_R	58_E	2.260	1.00
38_T	48_E	2.038	1.00
15_M	26_W	1.996	1.00
10_L	16_I	1.965	1.00
28_E	48_E	1.960	1.00
31_D	34_N	1.936	1.00
20_Y	39_V	1.793	1.00
37_A	53_V	1.746	1.00
7_K	11_S	1.586	1.00
3_V	53_V	1.495	1.00
31_D	38_T	1.491	1.00
10_L	27_I	1.444	1.00
15_M	42_L	1.315	0.99
14_E	17_N	1.304	0.99
6_A	27_I	1.295	0.99
28_E	38_T	1.260	0.99
38_T	50_E	1.242	0.99
35_G	54_S	1.218	0.99
40_H	48_E	1.210	0.99
10_L	26_W	1.203	0.99
3_V	35_G	1.146	0.98
18_V	27_I	1.145	0.98
49_Q	52_P	1.019	0.97
12_S	16_I	0.992	0.96
16_I	26_W	0.983	0.96
24_P	43_D	0.977	0.96
3_V	7_K	0.960	0.95
21_N	55_E	0.922	0.94
34_N	47_E	0.891	0.93
29_H	38_T	0.889	0.93
26_W	41_P	0.865	0.92
31_D	36_T	0.830	0.90
6_A	53_V	0.811	0.89
52_P	55_E	0.790	0.88
10_L	29_H	0.780	0.87
13_P	17_N	0.777	0.87
33_D	43_D	0.751	0.85
40_H	45_P	0.747	0.85
8_E	12_S	0.729	0.84
34_N	50_E	0.729	0.84
33_D	36_T	0.713	0.82
28_E	42_L	0.702	0.81
2_D	22_G	0.691	0.80
41_P	49_Q	0.690	0.80
13_P	19_T	0.685	0.80
23_V	43_D	0.682	0.79
21_N	45_P	0.661	0.77
35_G	43_D	0.652	0.76
8_E	11_S	0.651	0.76
14_E	43_D	0.651	0.76
23_V	41_P	0.645	0.75
5_R	8_E	0.634	0.74
25_V	41_P	0.633	0.74
1_M	38_T	0.632	0.74
20_Y	47_E	0.612	0.72
26_W	42_L	0.605	0.71
19_T	23_V	0.599	0.70
6_A	29_H	0.594	0.69
30_V	47_E	0.593	0.69
29_H	45_P	0.590	0.69
34_N	54_S	0.578	0.67
20_Y	49_Q	0.574	0.67
19_T	57_E	0.569	0.66
28_E	50_E	0.568	0.66
39_V	51_V	0.567	0.66
30_V	48_E	0.561	0.65
22_G	31_D	0.560	0.65
44_N	47_E	0.553	0.64
11_S	14_E	0.552	0.64
23_V	47_E	0.551	0.64
36_T	50_E	0.550	0.63
28_E	32_E	0.544	0.63
3_V	32_E	0.543	0.62
5_R	9_I	0.543	0.62
43_D	47_E	0.542	0.62
8_E	15_M	0.540	0.62
5_R	34_N	0.540	0.62
20_Y	55_E	0.531	0.61
20_Y	51_V	0.514	0.58
51_V	56_L	0.509	0.58
11_S	48_E	0.502	0.57
17_N	49_Q	0.501	0.56
6_A	30_V	0.500	0.56

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4anjA	1	0.569	30.4	0.836	Contact Map
3s6wA	1	0.8103	29.3	0.838	Contact Map
1i84S	2	0.9828	26	0.842	Contact Map
2v26A	1	0.5517	25	0.843	Contact Map
4nl7A	1	0.9828	24.1	0.844	Contact Map
2ycuA	1	0.6897	22.4	0.847	Contact Map
4qq6A	1	0.8621	22.3	0.847	Contact Map
1kk8A	1	0.9138	14.9	0.859	Contact Map
3qiiA	2	0.8103	14.8	0.859	Contact Map
4a4fA	1	0.9655	13.8	0.861	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0038 seconds.