K167R - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

K167R - K167R (NUC007) repeat

PFAM:	PF08065	Sequences: TKMPCKSPQPEPVDTPTSRKRRLKTPLGKVDVEEELSALRKPTQTPGETTHTPKEPVGDDKGIKAFKETPKQKLDPAENVTGSKRRPRTPKEKAQPLEDLAGFKELFQTP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	110 (110)
Sequences:	556 (393)
Seq/√Len:	37.5
META:	0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
23_L	104_K	2.758	1.00
4_P	9_Q	2.562	1.00
99_D	102_G	2.497	1.00
103_F	107_F	2.353	1.00
73_K	78_E	2.306	1.00
92_E	96_P	2.197	0.99
59_D	66_F	2.121	0.99
102_G	107_F	1.999	0.99
2_K	63_I	1.951	0.98
31_D	35_E	1.928	0.98
1_T	5_C	1.856	0.98
16_P	20_K	1.749	0.97
83_S	86_R	1.731	0.96
46_P	49_T	1.692	0.96
6_K	64_K	1.685	0.96
102_G	109_T	1.633	0.95
3_M	11_E	1.564	0.94
75_D	84_K	1.546	0.93
106_L	109_T	1.540	0.93
76_P	87_P	1.532	0.93
23_L	38_A	1.497	0.92
3_M	6_K	1.493	0.92
94_A	97_L	1.471	0.92
93_K	96_P	1.429	0.90
43_T	53_P	1.396	0.89
10_P	35_E	1.394	0.89
3_M	9_Q	1.387	0.89
8_P	101_A	1.379	0.89
71_K	86_R	1.360	0.88
90_P	109_T	1.337	0.87
100_L	109_T	1.322	0.86
4_P	10_P	1.312	0.86
67_K	80_V	1.305	0.86
89_T	92_E	1.278	0.85
107_F	110_P	1.269	0.84
97_L	106_L	1.233	0.82
4_P	95_Q	1.226	0.82
77_A	88_R	1.225	0.82
71_K	97_L	1.213	0.81
3_M	7_S	1.196	0.80
44_Q	98_E	1.176	0.79
23_L	70_P	1.164	0.78
64_K	71_K	1.141	0.77
44_Q	88_R	1.140	0.77
28_G	61_K	1.137	0.77
106_L	110_P	1.132	0.76
48_E	80_V	1.117	0.76
99_D	106_L	1.115	0.75
36_L	51_H	1.108	0.75
10_P	22_R	1.097	0.74
57_V	69_T	1.095	0.74
24_K	32_V	1.089	0.74
24_K	89_T	1.088	0.74
19_R	26_P	1.086	0.73
62_G	96_P	1.084	0.73
99_D	107_F	1.073	0.73
3_M	96_P	1.056	0.71
92_E	103_F	1.037	0.70
14_D	22_R	1.023	0.69
42_P	62_G	1.014	0.68
1_T	4_P	1.001	0.67
31_D	34_E	0.998	0.67
96_P	101_A	0.998	0.67
48_E	58_G	0.996	0.67
74_L	104_K	0.988	0.66
12_P	18_S	0.960	0.64
61_K	66_F	0.955	0.63
15_T	25_T	0.938	0.62
24_K	92_E	0.932	0.62
6_K	13_V	0.931	0.61
53_P	82_G	0.921	0.61
20_K	35_E	0.918	0.60
26_P	33_E	0.918	0.60
27_L	43_T	0.912	0.60
4_P	71_K	0.909	0.60
19_R	39_L	0.905	0.59
51_H	95_Q	0.904	0.59
87_P	100_L	0.903	0.59
21_R	37_S	0.901	0.59
2_K	7_S	0.898	0.59
16_P	109_T	0.896	0.58
6_K	66_F	0.891	0.58
50_T	73_K	0.872	0.56
59_D	75_D	0.872	0.56
70_P	90_P	0.864	0.56
54_K	64_K	0.863	0.56
16_P	22_R	0.858	0.55
7_S	99_D	0.855	0.55
59_D	104_K	0.850	0.54
32_V	40_R	0.849	0.54
26_P	107_F	0.846	0.54
40_R	59_D	0.836	0.53
79_N	83_S	0.822	0.52
25_T	71_K	0.818	0.52
10_P	13_V	0.818	0.52
32_V	56_P	0.818	0.52
34_E	63_I	0.812	0.51
4_P	16_P	0.809	0.51
72_Q	87_P	0.806	0.51
85_R	102_G	0.801	0.50
57_V	82_G	0.796	0.50
46_P	71_K	0.794	0.49
61_K	64_K	0.791	0.49
20_K	31_D	0.788	0.49
57_V	72_Q	0.786	0.49
37_S	49_T	0.781	0.48
30_V	94_A	0.768	0.47
20_K	29_K	0.760	0.46
14_D	42_P	0.758	0.46
33_E	104_K	0.754	0.46
87_P	97_L	0.752	0.46
1_T	95_Q	0.736	0.44
47_G	58_G	0.735	0.44
8_P	14_D	0.726	0.43
65_A	76_P	0.721	0.43
4_P	101_A	0.715	0.43
5_C	8_P	0.707	0.42
36_L	65_A	0.704	0.42
8_P	63_I	0.704	0.42
44_Q	59_D	0.703	0.41
26_P	91_K	0.696	0.41
23_L	65_A	0.695	0.41
26_P	42_P	0.693	0.41
14_D	32_V	0.689	0.40
55_E	59_D	0.687	0.40
27_L	62_G	0.676	0.39
44_Q	90_P	0.667	0.38
97_L	105_E	0.663	0.38
57_V	96_P	0.662	0.38
2_K	9_Q	0.657	0.38
57_V	61_K	0.656	0.38
18_S	21_R	0.654	0.37
31_D	68_E	0.652	0.37
75_D	95_Q	0.645	0.37
54_K	68_E	0.629	0.35
46_P	70_P	0.620	0.35
15_T	85_R	0.618	0.34
87_P	92_E	0.611	0.34
72_Q	81_T	0.608	0.34
58_G	80_V	0.603	0.33
81_T	92_E	0.588	0.32
60_D	67_K	0.583	0.32
73_K	103_F	0.579	0.31
70_P	78_E	0.567	0.30
17_T	22_R	0.562	0.30
86_R	95_Q	0.556	0.30
47_G	53_P	0.549	0.29
28_G	58_G	0.547	0.29
44_Q	81_T	0.542	0.29
35_E	84_K	0.538	0.28
17_T	94_A	0.534	0.28
27_L	35_E	0.534	0.28
79_N	89_T	0.530	0.28
21_R	28_G	0.530	0.28
11_E	18_S	0.530	0.28
22_R	33_E	0.526	0.27
46_P	69_T	0.525	0.27
29_K	37_S	0.522	0.27
90_P	100_L	0.521	0.27
85_R	101_A	0.516	0.27
5_C	66_F	0.512	0.26
12_P	17_T	0.509	0.26
52_T	108_Q	0.505	0.26
73_K	88_R	0.504	0.26
8_P	36_L	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2l5rA	1	0.0818	1.5	0.952	Contact Map
3uitA	3	0.3455	1.4	0.953	Contact Map
3adyA	1	0.0545	1	0.957	Contact Map
3v8xA	1	0.1727	0.9	0.958	Contact Map
1r8iA	1	0.4273	0.9	0.958	Contact Map
2mn3A	1	0.2	0.8	0.959	Contact Map
1fepA	1	0.4364	0.7	0.961	Contact Map
4h63K	1	0.3545	0.7	0.962	Contact Map
1g6uA	3	0.2909	0.6	0.962	Contact Map
3ghpA	1	0.0909	0.6	0.962	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.