DUF1651 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1651 - Protein of unknown function (DUF1651)

PFAM:	PF07864	Sequences: EGWLINPNRSRVKRFEKDEKSSDNSPYVFIDSGGIVPGGEPPLMKTRRVLSIEEAREEWKELLSEGWRKTEPQW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	74 (72)
Sequences:	1317 (549)
Seq/√Len:	64.7
META:	0.917

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_S	25_S	2.677	1.00
38_G	41_P	2.452	1.00
70_T	73_Q	2.397	1.00
2_G	56_R	2.242	1.00
13_K	32_S	2.067	1.00
20_K	24_N	1.897	1.00
6_N	10_S	1.765	1.00
51_S	54_E	1.712	0.99
30_I	33_G	1.691	0.99
17_K	20_K	1.681	0.99
39_G	45_K	1.658	0.99
16_E	29_F	1.582	0.99
61_E	65_E	1.519	0.99
37_P	40_E	1.519	0.99
52_I	69_K	1.495	0.98
8_N	12_V	1.468	0.98
58_E	61_E	1.435	0.98
13_K	48_R	1.424	0.98
22_S	26_P	1.380	0.97
48_R	58_E	1.347	0.97
36_V	43_L	1.342	0.97
48_R	54_E	1.303	0.96
39_G	43_L	1.300	0.96
3_W	14_R	1.299	0.96
28_V	33_G	1.271	0.96
31_D	34_G	1.270	0.96
6_N	13_K	1.237	0.95
60_K	63_L	1.233	0.95
16_E	31_D	1.227	0.95
6_N	11_R	1.216	0.95
50_L	58_E	1.202	0.94
31_D	47_R	1.191	0.94
21_S	24_N	1.121	0.92
33_G	43_L	1.115	0.92
7_P	35_I	1.109	0.92
60_K	68_R	1.093	0.91
55_A	59_W	1.046	0.89
37_P	42_P	1.038	0.89
33_G	42_P	1.034	0.88
35_I	73_Q	1.033	0.88
21_S	25_S	1.031	0.88
3_W	50_L	1.022	0.88
60_K	64_S	0.983	0.86
45_K	57_E	0.978	0.85
15_F	55_A	0.977	0.85
61_E	68_R	0.959	0.84
7_P	19_E	0.930	0.82
14_R	31_D	0.918	0.82
43_L	72_P	0.913	0.81
52_I	56_R	0.903	0.81
18_D	26_P	0.903	0.81
11_R	32_S	0.888	0.79
32_S	46_T	0.865	0.78
33_G	36_V	0.860	0.77
18_D	31_D	0.860	0.77
9_R	13_K	0.833	0.75
65_E	68_R	0.805	0.72
5_I	12_V	0.794	0.71
16_E	20_K	0.782	0.70
18_D	22_S	0.780	0.70
44_M	47_R	0.776	0.70
34_G	45_K	0.774	0.69
30_I	64_S	0.771	0.69
26_P	49_V	0.766	0.69
17_K	25_S	0.763	0.68
6_N	9_R	0.758	0.68
3_W	59_W	0.757	0.68
3_W	7_P	0.754	0.67
27_Y	51_S	0.754	0.67
65_E	72_P	0.749	0.67
21_S	29_F	0.734	0.65
14_R	43_L	0.727	0.65
14_R	23_D	0.726	0.64
16_E	54_E	0.715	0.63
5_I	10_S	0.705	0.62
52_I	64_S	0.704	0.62
18_D	28_V	0.685	0.60
17_K	24_N	0.684	0.60
30_I	50_L	0.675	0.59
13_K	58_E	0.672	0.58
23_D	53_E	0.659	0.57
5_I	11_R	0.657	0.57
64_S	72_P	0.653	0.56
65_E	73_Q	0.650	0.56
13_K	19_E	0.649	0.56
5_I	9_R	0.640	0.55
68_R	73_Q	0.628	0.53
17_K	23_D	0.624	0.53
8_N	11_R	0.621	0.53
52_I	59_W	0.613	0.52
14_R	17_K	0.611	0.51
53_E	71_E	0.603	0.50
63_L	72_P	0.601	0.50
69_K	72_P	0.583	0.48
31_D	35_I	0.580	0.48
34_G	43_L	0.561	0.46
43_L	47_R	0.559	0.45
39_G	42_P	0.547	0.44
7_P	12_V	0.546	0.44
14_R	61_E	0.546	0.44
37_P	43_L	0.542	0.43
27_Y	54_E	0.532	0.42
27_Y	35_I	0.528	0.42
12_V	35_I	0.521	0.41
49_V	54_E	0.518	0.41
19_E	32_S	0.501	0.39
9_R	12_V	0.501	0.39
23_D	29_F	0.500	0.39

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1wdjA	3	0.6351	10.6	0.883	Contact Map
3bq3A	2	0.9189	10.1	0.884	Contact Map
4gbaA	1	0.9459	8.4	0.888	Contact Map
3ecqA	1	0.8649	8.2	0.888	Contact Map
3ot2A	2	0.7027	5.4	0.897	Contact Map
3tduA	1	0.9054	5.3	0.898	Contact Map
2b7eA	1	0.2973	5	0.899	Contact Map
2zxqA	1	0.8649	4.2	0.903	Contact Map
1uzcA	1	0.4324	3.6	0.906	Contact Map
3kevA	1	0.9054	3.4	0.906	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.