DUF1634 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1634 - Protein of unknown function (DUF1634)

PFAM:	PF07843	Sequences: IGRLLRAGVLLSAAVVLAGGVLYLARHGGSYGEPAFLRSLSGILRGALALRPRAIIQLGLLLLIATPVARVAFSLVAFARERDRLYVAITLIVLAVLLYSLF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	102 (101)
Sequences:	6571 (5042)
Seq/√Len:	501.7
META:	0.94

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
15_V	62_L	3.549	1.00
22_L	52_P	3.461	1.00
46_G	54_A	3.177	1.00
75_L	91_L	3.128	1.00
74_S	90_T	2.691	1.00
76_V	80_R	2.685	1.00
3_R	6_R	2.303	1.00
39_S	42_G	2.148	1.00
79_A	87_V	2.087	1.00
88_A	92_I	1.978	1.00
85_L	89_I	1.932	1.00
95_A	99_Y	1.900	1.00
3_R	7_A	1.767	1.00
10_L	14_A	1.701	1.00
92_I	96_V	1.626	1.00
72_A	94_L	1.622	1.00
4_L	73_F	1.607	1.00
46_G	51_R	1.517	1.00
91_L	95_A	1.473	1.00
45_R	49_A	1.466	1.00
22_L	55_I	1.458	1.00
7_A	11_L	1.451	1.00
9_V	13_A	1.430	1.00
85_L	88_A	1.387	1.00
14_A	18_A	1.371	1.00
75_L	90_T	1.328	1.00
18_A	55_I	1.321	1.00
22_L	26_R	1.318	1.00
79_A	84_R	1.312	1.00
83_D	86_Y	1.301	1.00
2_G	6_R	1.297	1.00
27_H	30_S	1.285	1.00
73_F	77_A	1.253	1.00
71_V	97_L	1.246	1.00
84_R	88_A	1.219	1.00
43_I	47_A	1.201	1.00
94_L	98_L	1.198	1.00
69_A	73_F	1.179	1.00
4_L	69_A	1.174	1.00
44_L	48_L	1.156	1.00
16_V	56_I	1.149	1.00
74_S	78_F	1.128	1.00
75_L	79_A	1.095	1.00
16_V	59_G	1.078	1.00
47_A	58_L	1.070	1.00
8_G	66_T	1.069	1.00
75_L	87_V	1.066	1.00
15_V	55_I	1.047	1.00
90_T	93_V	1.043	1.00
41_S	45_R	1.024	1.00
51_R	54_A	1.021	1.00
33_E	37_L	1.006	1.00
7_A	10_L	0.996	1.00
20_G	23_Y	0.969	1.00
45_R	48_L	0.965	1.00
26_R	52_P	0.961	1.00
71_V	78_F	0.956	1.00
47_A	50_L	0.951	1.00
60_L	63_L	0.935	1.00
74_S	77_A	0.927	1.00
78_F	86_Y	0.926	1.00
27_H	52_P	0.925	1.00
97_L	101_L	0.920	1.00
34_P	37_L	0.919	1.00
15_V	58_L	0.919	1.00
84_R	87_V	0.897	1.00
33_E	38_R	0.892	1.00
40_L	44_L	0.880	1.00
17_L	21_V	0.875	1.00
16_V	20_G	0.866	1.00
44_L	47_A	0.848	1.00
12_S	66_T	0.845	1.00
18_A	22_L	0.842	1.00
21_V	25_A	0.815	1.00
64_I	67_P	0.806	1.00
23_Y	56_I	0.800	1.00
20_G	27_H	0.792	1.00
36_F	46_G	0.786	1.00
67_P	93_V	0.785	1.00
64_I	101_L	0.784	1.00
42_G	46_G	0.780	1.00
64_I	70_R	0.775	1.00
12_S	63_L	0.774	1.00
48_L	51_R	0.763	1.00
19_G	52_P	0.754	1.00
35_A	38_R	0.745	1.00
72_A	76_V	0.742	1.00
12_S	62_L	0.740	1.00
33_E	36_F	0.728	1.00
27_H	53_R	0.719	1.00
86_Y	89_I	0.713	1.00
74_S	86_Y	0.713	1.00
70_R	74_S	0.713	1.00
68_V	97_L	0.701	1.00
11_L	62_L	0.696	1.00
46_G	49_A	0.691	1.00
61_L	65_A	0.688	1.00
70_R	93_V	0.687	1.00
16_V	60_L	0.686	1.00
41_S	44_L	0.683	1.00
35_A	39_S	0.676	1.00
13_A	97_L	0.671	1.00
68_V	98_L	0.666	1.00
87_V	91_L	0.661	1.00
46_G	50_L	0.658	1.00
47_A	55_I	0.655	1.00
5_L	8_G	0.647	1.00
98_L	101_L	0.636	1.00
75_L	94_L	0.634	1.00
83_D	89_I	0.634	1.00
36_F	51_R	0.623	1.00
66_T	86_Y	0.621	1.00
79_A	82_R	0.619	1.00
86_Y	90_T	0.618	1.00
23_Y	28_G	0.617	1.00
42_G	45_R	0.616	1.00
18_A	50_L	0.616	1.00
1_I	74_S	0.611	1.00
64_I	68_V	0.603	0.99
43_I	57_Q	0.595	0.99
37_L	42_G	0.592	0.99
96_V	100_S	0.589	0.99
80_R	89_I	0.589	0.99
66_T	70_R	0.588	0.99
84_R	95_A	0.587	0.99
11_L	14_A	0.578	0.99
43_I	54_A	0.576	0.99
71_V	94_L	0.575	0.99
12_S	20_G	0.573	0.99
5_L	70_R	0.572	0.99
19_G	56_I	0.568	0.99
36_F	57_Q	0.567	0.99
30_S	33_E	0.564	0.99
26_R	53_R	0.563	0.99
19_G	55_I	0.549	0.99
64_I	93_V	0.547	0.99
2_G	9_V	0.541	0.99
47_A	54_A	0.538	0.99
8_G	71_V	0.538	0.99
53_R	57_Q	0.537	0.99
71_V	90_T	0.537	0.99
74_S	89_I	0.534	0.99
32_G	35_A	0.525	0.99
77_A	80_R	0.524	0.98
43_I	58_L	0.524	0.98
32_G	39_S	0.518	0.98
73_F	100_S	0.515	0.98
50_L	55_I	0.515	0.98
39_S	43_I	0.515	0.98
22_L	25_A	0.513	0.98
63_L	86_Y	0.503	0.98
69_A	72_A	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3giaA	1	1	7	0.882	Contact Map
2vpzC	2	0.8627	5	0.89	Contact Map
1v54C	1	0.9314	4.8	0.891	Contact Map
4ev6A	3	0.6275	4	0.895	Contact Map
1qleC	1	0.9314	3.1	0.9	Contact Map
4b19A	1	0.2745	2.6	0.903	Contact Map
4i0uA	4	0.6078	2.5	0.905	Contact Map
4xtlA	1	0.7059	2.1	0.909	Contact Map
1m56C	2	0.9314	2	0.91	Contact Map
3j1zP	8	0.9608	1.9	0.911	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.