DUF1638 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1638 - Protein of unknown function (DUF1638)

PFAM:	PF07796	Sequences: CLPAGLHNRPEKLRAALQEAIDAARGRYDRILVGYGDCGGGLDGLKLAEEGVVRPRGHHCYEFFLGSEEFYAELFEEEPGTFYLTDGWVRHFDRLVGLGLGPELADEYFGNMFKNYTRLVYLDTGQTDDPELREKAREAAERLGLPFEERPGGLGLLERLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	161 (155)
Sequences:	9467 (6503)
Seq/√Len:	522.4
META:	0.935

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
133_R	149_E	4.230	1.00
62_E	67_S	2.728	1.00
18_Q	22_D	2.572	1.00
118_R	148_E	2.482	1.00
16_A	19_E	2.371	1.00
133_R	147_F	2.313	1.00
137_R	141_E	2.298	1.00
18_Q	49_E	2.297	1.00
9_R	12_K	2.046	1.00
20_A	23_A	1.993	1.00
41_G	44_G	1.891	1.00
81_T	118_R	1.858	1.00
78_E	117_T	1.839	1.00
102_P	106_D	1.796	1.00
75_F	83_Y	1.780	1.00
107_E	110_G	1.779	1.00
135_K	138_E	1.757	1.00
91_H	94_R	1.754	1.00
80_G	117_T	1.751	1.00
136_A	147_F	1.730	1.00
101_G	104_L	1.703	1.00
117_T	146_P	1.643	1.00
133_R	137_R	1.623	1.00
43_D	54_R	1.611	1.00
6_L	16_A	1.588	1.00
40_G	43_D	1.576	1.00
30_R	53_V	1.572	1.00
123_D	151_P	1.568	1.00
64_F	85_T	1.543	1.00
12_K	15_A	1.538	1.00
120_V	150_R	1.505	1.00
55_P	63_F	1.500	1.00
155_G	159_R	1.495	1.00
22_D	50_E	1.488	1.00
122_L	152_G	1.468	1.00
14_R	45_L	1.462	1.00
73_E	77_E	1.451	1.00
72_A	76_E	1.447	1.00
107_E	111_N	1.444	1.00
135_K	139_A	1.441	1.00
125_G	151_P	1.427	1.00
81_T	120_V	1.426	1.00
18_Q	50_E	1.419	1.00
70_F	73_E	1.410	1.00
42_L	54_R	1.373	1.00
134_E	138_E	1.373	1.00
108_Y	111_N	1.369	1.00
21_I	31_I	1.359	1.00
21_I	50_E	1.358	1.00
65_L	122_L	1.343	1.00
15_A	19_E	1.343	1.00
104_L	107_E	1.343	1.00
19_E	23_A	1.331	1.00
134_E	137_R	1.324	1.00
97_G	102_P	1.318	1.00
69_E	73_E	1.309	1.00
78_E	118_R	1.305	1.00
12_K	16_A	1.299	1.00
58_H	62_E	1.298	1.00
139_A	143_L	1.283	1.00
138_E	141_E	1.275	1.00
91_H	95_L	1.269	1.00
89_V	135_K	1.250	1.00
57_G	62_E	1.248	1.00
125_G	149_E	1.207	1.00
128_D	133_R	1.203	1.00
34_G	55_P	1.179	1.00
2_L	35_Y	1.148	1.00
138_E	142_R	1.147	1.00
17_L	42_L	1.141	1.00
123_D	149_E	1.140	1.00
24_A	27_R	1.138	1.00
137_R	147_F	1.132	1.00
84_L	119_L	1.113	1.00
106_D	110_G	1.104	1.00
74_L	77_E	1.089	1.00
104_L	111_N	1.086	1.00
16_A	20_A	1.083	1.00
30_R	51_G	1.080	1.00
101_G	105_A	1.066	1.00
25_R	50_E	1.062	1.00
36_G	57_G	1.052	1.00
100_L	108_Y	1.049	1.00
66_G	69_E	1.044	1.00
93_D	142_R	1.029	1.00
11_E	14_R	1.025	1.00
97_G	105_A	1.014	1.00
89_V	132_L	1.014	1.00
33_V	47_L	1.013	1.00
47_L	50_E	1.000	1.00
21_I	52_V	0.991	1.00
32_L	53_V	0.991	1.00
104_L	108_Y	0.990	1.00
36_G	63_F	0.976	1.00
98_L	101_G	0.973	1.00
74_L	120_V	0.966	1.00
128_D	151_P	0.959	1.00
24_A	28_Y	0.947	1.00
39_G	43_D	0.930	1.00
69_E	150_R	0.929	1.00
20_A	24_A	0.924	1.00
89_V	139_A	0.913	1.00
25_R	49_E	0.909	1.00
22_D	48_A	0.894	1.00
46_K	49_E	0.889	1.00
130_P	134_E	0.884	1.00
21_I	45_L	0.872	1.00
24_A	31_I	0.870	1.00
100_L	105_A	0.869	1.00
136_A	140_A	0.866	1.00
14_R	41_G	0.860	1.00
92_F	95_L	0.859	1.00
123_D	129_D	0.857	1.00
65_L	74_L	0.857	1.00
121_Y	129_D	0.841	1.00
92_F	96_V	0.840	1.00
32_L	160_L	0.839	1.00
119_L	140_A	0.839	1.00
44_G	48_A	0.832	1.00
84_L	136_A	0.831	1.00
74_L	78_E	0.828	1.00
98_L	108_Y	0.820	1.00
57_G	63_F	0.817	1.00
17_L	33_V	0.796	1.00
128_D	149_E	0.789	1.00
97_G	101_G	0.784	1.00
120_V	148_E	0.775	1.00
73_E	76_E	0.774	1.00
14_R	18_Q	0.763	1.00
118_R	146_P	0.760	1.00
74_L	118_R	0.751	1.00
62_E	156_L	0.746	1.00
59_H	62_E	0.745	1.00
3_P	8_N	0.745	1.00
5_G	8_N	0.740	1.00
105_A	110_G	0.739	1.00
4_A	8_N	0.738	1.00
128_D	131_E	0.730	1.00
119_L	136_A	0.729	1.00
105_A	108_Y	0.719	1.00
68_E	72_A	0.716	1.00
78_E	146_P	0.716	1.00
37_D	40_G	0.716	1.00
76_E	79_P	0.712	1.00
67_S	156_L	0.709	1.00
155_G	158_E	0.708	1.00
93_D	138_E	0.708	1.00
127_T	130_P	0.707	1.00
41_G	45_L	0.701	1.00
156_L	159_R	0.686	1.00
3_P	16_A	0.685	1.00
101_G	108_Y	0.678	1.00
125_G	128_D	0.675	1.00
45_L	50_E	0.673	1.00
61_Y	88_W	0.672	1.00
70_F	83_Y	0.670	1.00
32_L	36_G	0.669	1.00
98_L	102_P	0.668	1.00
99_G	108_Y	0.659	1.00
72_A	75_F	0.657	1.00
102_P	105_A	0.656	1.00
92_F	97_G	0.656	1.00
62_E	68_E	0.655	1.00
64_F	124_T	0.655	1.00
103_E	107_E	0.655	1.00
130_P	133_R	0.654	1.00
18_Q	45_L	0.653	1.00
39_G	44_G	0.651	1.00
84_L	139_A	0.649	1.00
55_P	160_L	0.649	1.00
75_F	79_P	0.647	1.00
84_L	89_V	0.645	1.00
47_L	52_V	0.643	1.00
154_L	158_E	0.640	1.00
104_L	109_F	0.639	1.00
39_G	42_L	0.638	1.00
154_L	157_L	0.631	1.00
131_E	134_E	0.629	1.00
70_F	74_L	0.626	1.00
136_A	139_A	0.623	1.00
31_I	52_V	0.619	1.00
81_T	116_Y	0.619	1.00
22_D	25_R	0.614	1.00
131_E	135_K	0.612	1.00
39_G	45_L	0.605	1.00
126_Q	130_P	0.605	1.00
119_L	145_L	0.603	1.00
17_L	45_L	0.598	1.00
31_I	50_E	0.595	0.99
126_Q	129_D	0.594	0.99
125_G	133_R	0.588	0.99
81_T	117_T	0.586	0.99
23_A	26_G	0.586	0.99
74_L	150_R	0.581	0.99
105_A	142_R	0.573	0.99
93_D	96_V	0.569	0.99
123_D	126_Q	0.566	0.99
33_V	52_V	0.566	0.99
121_Y	133_R	0.564	0.99
77_E	80_G	0.564	0.99
21_I	47_L	0.561	0.99
140_A	147_F	0.552	0.99
128_D	132_L	0.550	0.99
102_P	110_G	0.549	0.99
92_F	105_A	0.549	0.99
132_L	135_K	0.547	0.99
19_E	22_D	0.545	0.99
13_L	41_G	0.544	0.99
97_G	100_L	0.541	0.99
2_L	6_L	0.536	0.99
102_P	108_Y	0.536	0.99
21_I	24_A	0.535	0.99
121_Y	147_F	0.534	0.99
21_I	25_R	0.530	0.99
45_L	52_V	0.527	0.99
127_T	151_P	0.525	0.99
129_D	132_L	0.524	0.99
5_G	94_R	0.524	0.99
75_F	80_G	0.523	0.99
5_G	9_R	0.522	0.99
67_S	70_F	0.519	0.99
124_T	154_L	0.517	0.99
99_G	102_P	0.517	0.99
106_D	109_F	0.517	0.99
34_G	157_L	0.517	0.99
82_F	89_V	0.516	0.99
85_T	88_W	0.510	0.98
141_E	144_G	0.510	0.98
39_G	59_H	0.510	0.98
100_L	107_E	0.502	0.98
121_Y	132_L	0.502	0.98
48_A	51_G	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2bnlA	2	0.5528	42	0.919	Contact Map
2goyA	3	0.5714	21.4	0.93	Contact Map
4u9bA	1	0.4658	17.6	0.933	Contact Map
3tfgA	1	0.4658	15.3	0.935	Contact Map
3sj5A	1	0.472	15.3	0.935	Contact Map
4z0nA	1	0.8509	15.2	0.935	Contact Map
4r0gA	2	0.5217	13.7	0.936	Contact Map
4pe6A	1	0.8075	11.7	0.938	Contact Map
2fvyA	1	0.8509	11.2	0.939	Contact Map
3l49A	2	0.8012	11	0.939	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.