DC_STAMP - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DC_STAMP - DC-STAMP-like protein

PFAM:	PF07782	Sequences: FDNIYITKYFRQIDARRKKQGKPTVLPLKKKERKKYIRPTSLRLSRKERKNLLLGLLLLLLHLLLLLLLVALDYLLYWLLDTVRRHAQGEPVVPVPLKLSVKVEGTGYIADLLRDLVSAFNPLSYGNLSLSSARCLPQPSPPDSSTYLVIGLLYLLLLLLVLLEAYALRLRRVIAASFYPSREKERILYLY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	191 (191)
Sequences:	567 (356)
Seq/√Len:	25.7
META:	0.092

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_R	191_Y	4.794	1.00
176_A	183_E	3.628	1.00
27_P	32_E	3.150	1.00
186_R	190_L	2.925	1.00
166_Y	169_R	2.916	1.00
172_R	183_E	2.898	1.00
182_R	185_E	2.886	1.00
13_I	191_Y	2.709	0.99
15_A	18_K	2.571	0.99
110_A	114_R	2.546	0.99
183_E	187_I	2.497	0.99
180_P	184_K	2.228	0.98
14_D	32_E	2.176	0.97
5_Y	183_E	2.055	0.96
10_F	26_L	1.976	0.95
174_I	181_S	1.974	0.95
176_A	187_I	1.954	0.95
67_L	152_L	1.949	0.95
1_F	29_K	1.937	0.94
105_G	114_R	1.915	0.94
73_D	139_P	1.863	0.93
6_I	26_L	1.780	0.91
2_D	5_Y	1.777	0.91
105_G	110_A	1.770	0.91
86_H	99_L	1.764	0.91
83_V	173_V	1.723	0.90
25_V	36_Y	1.715	0.90
122_P	131_S	1.641	0.88
13_I	17_R	1.569	0.85
7_T	28_L	1.566	0.85
148_L	152_L	1.554	0.85
178_F	189_Y	1.544	0.84
63_L	71_A	1.524	0.83
103_V	114_R	1.519	0.83
63_L	154_Y	1.497	0.82
14_D	26_L	1.482	0.82
113_L	127_N	1.455	0.80
182_R	191_Y	1.440	0.80
28_L	32_E	1.435	0.79
141_P	163_L	1.428	0.79
102_K	179_Y	1.419	0.79
26_L	32_E	1.394	0.77
2_D	171_R	1.394	0.77
99_L	103_V	1.393	0.77
67_L	157_L	1.388	0.77
38_R	174_I	1.386	0.77
8_K	19_K	1.376	0.76
9_Y	13_I	1.366	0.76
25_V	32_E	1.338	0.74
36_Y	41_S	1.324	0.74
66_L	154_Y	1.309	0.73
55_G	72_L	1.307	0.73
188_L	191_Y	1.279	0.71
1_F	114_R	1.273	0.71
55_G	66_L	1.269	0.70
172_R	176_A	1.265	0.70
14_D	33_R	1.262	0.70
117_V	121_N	1.248	0.69
80_L	139_P	1.245	0.69
80_L	107_G	1.243	0.69
12_Q	16_R	1.238	0.68
59_L	161_V	1.227	0.68
83_V	88_Q	1.218	0.67
107_G	114_R	1.207	0.66
70_V	147_Y	1.201	0.66
160_L	185_E	1.190	0.65
2_D	166_Y	1.171	0.64
112_L	120_F	1.166	0.64
52_L	170_L	1.165	0.64
69_L	74_Y	1.161	0.63
79_L	151_G	1.157	0.63
156_L	159_L	1.153	0.63
14_D	27_P	1.142	0.62
64_L	189_Y	1.132	0.61
29_K	36_Y	1.127	0.61
105_G	111_D	1.122	0.61
35_K	41_S	1.118	0.60
63_L	67_L	1.115	0.60
41_S	74_Y	1.111	0.60
28_L	170_L	1.109	0.60
110_A	116_L	1.100	0.59
58_L	150_I	1.095	0.59
58_L	66_L	1.092	0.58
21_G	90_E	1.085	0.58
94_P	166_Y	1.075	0.57
24_T	39_P	1.071	0.57
14_D	105_G	1.063	0.56
10_F	14_D	1.060	0.56
79_L	130_L	1.049	0.55
66_L	70_V	1.048	0.55
80_L	159_L	1.045	0.55
21_G	133_A	1.042	0.55
1_F	100_S	1.036	0.54
31_K	179_Y	1.036	0.54
1_F	42_L	1.034	0.54
41_S	150_I	1.029	0.54
69_L	161_V	1.019	0.53
114_R	120_F	1.016	0.53
172_R	175_A	1.015	0.53
39_P	55_G	1.014	0.53
156_L	162_L	1.008	0.52
46_R	67_L	1.007	0.52
168_L	171_R	1.002	0.52
16_R	181_S	0.998	0.52
49_R	70_V	0.997	0.52
71_A	151_G	0.995	0.51
10_F	25_V	0.991	0.51
6_I	112_L	0.980	0.50
52_L	150_I	0.975	0.50
99_L	152_L	0.972	0.50
34_K	49_R	0.971	0.50
33_R	50_K	0.970	0.50
184_K	191_Y	0.951	0.48
48_E	73_D	0.950	0.48
60_L	118_S	0.945	0.48
11_R	15_A	0.942	0.47
2_D	183_E	0.938	0.47
36_Y	130_L	0.938	0.47
32_E	105_G	0.932	0.47
42_L	148_L	0.929	0.47
4_I	183_E	0.924	0.46
89_G	132_S	0.919	0.46
94_P	108_Y	0.903	0.45
67_L	81_D	0.895	0.44
21_G	128_L	0.895	0.44
7_T	37_I	0.891	0.44
78_W	142_P	0.890	0.44
108_Y	116_L	0.890	0.44
57_L	68_L	0.888	0.44
16_R	25_V	0.885	0.43
127_N	130_L	0.883	0.43
140_S	155_L	0.880	0.43
107_G	120_F	0.879	0.43
110_A	113_L	0.872	0.42
74_Y	78_W	0.871	0.42
34_K	138_Q	0.865	0.42
48_E	103_V	0.865	0.42
19_K	156_L	0.862	0.42
17_R	105_G	0.854	0.41
119_A	178_F	0.848	0.41
29_K	38_R	0.842	0.40
144_S	160_L	0.840	0.40
136_L	139_P	0.839	0.40
19_K	45_S	0.838	0.40
131_S	191_Y	0.837	0.40
152_L	156_L	0.837	0.40
27_P	137_P	0.819	0.39
30_K	41_S	0.818	0.39
89_G	95_V	0.816	0.38
38_R	61_L	0.813	0.38
68_L	76_L	0.810	0.38
44_L	117_V	0.810	0.38
175_A	183_E	0.804	0.38
137_P	165_A	0.802	0.37
146_T	158_L	0.801	0.37
8_K	15_A	0.801	0.37
14_D	25_V	0.800	0.37
71_A	177_S	0.795	0.37
120_F	125_Y	0.794	0.37
9_Y	17_R	0.793	0.37
42_L	185_E	0.791	0.37
113_L	116_L	0.787	0.36
103_V	169_R	0.784	0.36
43_R	47_K	0.774	0.36
12_Q	95_V	0.773	0.35
40_T	58_L	0.767	0.35
9_Y	184_K	0.766	0.35
1_F	48_E	0.760	0.35
152_L	181_S	0.757	0.34
100_S	138_Q	0.755	0.34
124_S	127_N	0.745	0.34
4_I	161_V	0.736	0.33
110_A	115_D	0.735	0.33
43_R	64_L	0.732	0.33
97_L	142_P	0.731	0.33
33_R	121_N	0.726	0.32
110_A	189_Y	0.726	0.32
22_K	126_G	0.725	0.32
66_L	93_V	0.721	0.32
76_L	138_Q	0.716	0.32
6_I	176_A	0.715	0.32
3_N	7_T	0.715	0.32
103_V	117_V	0.715	0.32
101_V	117_V	0.713	0.32
5_Y	130_L	0.713	0.32
27_P	36_Y	0.707	0.31
113_L	121_N	0.706	0.31
110_A	119_A	0.704	0.31
79_L	149_V	0.703	0.31
81_D	85_R	0.694	0.30
169_R	186_R	0.689	0.30
14_D	17_R	0.683	0.30
170_L	189_Y	0.682	0.30
143_D	159_L	0.680	0.29
6_I	25_V	0.674	0.29
1_F	155_L	0.670	0.29
49_R	150_I	0.666	0.29
15_A	29_K	0.664	0.29
10_F	167_A	0.658	0.28
14_D	37_I	0.657	0.28
17_R	24_T	0.654	0.28
169_R	182_R	0.654	0.28
50_K	120_F	0.653	0.28
5_Y	172_R	0.651	0.28
28_L	137_P	0.651	0.28
135_C	186_R	0.649	0.28
157_L	172_R	0.648	0.28
52_L	166_Y	0.647	0.28
44_L	52_L	0.647	0.28
1_F	16_R	0.639	0.27
11_R	37_I	0.638	0.27
15_A	159_L	0.635	0.27
117_V	124_S	0.634	0.27
42_L	71_A	0.632	0.27
123_L	179_Y	0.632	0.27
129_S	152_L	0.624	0.26
123_L	175_A	0.617	0.26
97_L	132_S	0.614	0.26
44_L	165_A	0.614	0.26
11_R	88_Q	0.609	0.25
22_K	102_K	0.608	0.25
78_W	151_G	0.606	0.25
83_V	137_P	0.604	0.25
121_N	185_E	0.603	0.25
36_Y	165_A	0.602	0.25
23_P	189_Y	0.601	0.25
57_L	161_V	0.601	0.25
111_D	114_R	0.601	0.25
7_T	139_P	0.599	0.25
57_L	116_L	0.598	0.25
105_G	112_L	0.595	0.25
93_V	126_G	0.591	0.24
56_L	140_S	0.591	0.24
59_L	150_I	0.586	0.24
22_K	170_L	0.585	0.24
86_H	91_P	0.582	0.24
48_E	169_R	0.580	0.24
34_K	117_V	0.580	0.24
186_R	191_Y	0.580	0.24
16_R	171_R	0.575	0.23
44_L	59_L	0.573	0.23
107_G	110_A	0.573	0.23
89_G	97_L	0.573	0.23
101_V	111_D	0.571	0.23
54_L	167_A	0.569	0.23
69_L	164_E	0.569	0.23
3_N	135_C	0.569	0.23
107_G	121_N	0.562	0.23
88_Q	187_I	0.562	0.23
2_D	172_R	0.560	0.23
64_L	71_A	0.559	0.23
47_K	156_L	0.559	0.23
112_L	117_V	0.558	0.23
10_F	187_I	0.556	0.22
25_V	76_L	0.554	0.22
164_E	175_A	0.552	0.22
174_I	182_R	0.549	0.22
37_I	183_E	0.548	0.22
146_T	166_Y	0.548	0.22
37_I	191_Y	0.547	0.22
87_A	97_L	0.545	0.22
10_F	91_P	0.545	0.22
3_N	10_F	0.543	0.22
82_T	142_P	0.540	0.22
72_L	93_V	0.537	0.22
34_K	64_L	0.536	0.21
114_R	117_V	0.533	0.21
77_Y	126_G	0.530	0.21
127_N	134_R	0.525	0.21
19_K	70_V	0.524	0.21
21_G	81_D	0.521	0.21
63_L	139_P	0.520	0.21
63_L	77_Y	0.520	0.21
145_S	170_L	0.518	0.21
41_S	44_L	0.516	0.21
96_P	134_R	0.516	0.21
25_V	31_K	0.514	0.20
145_S	185_E	0.513	0.20
179_Y	186_R	0.512	0.20
10_F	39_P	0.511	0.20
177_S	187_I	0.511	0.20
140_S	154_Y	0.508	0.20
1_F	86_H	0.505	0.20
39_P	110_A	0.502	0.20
153_L	179_Y	0.501	0.20
37_I	120_F	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2zjsE	1	0.2408	17.2	0.947	Contact Map
3bo0B	1	0.3298	11.2	0.951	Contact Map
3dinD	1	0.2932	10.8	0.951	Contact Map
3dl8C	1	0.1832	10.5	0.952	Contact Map
3nkgA	1	0.2932	5.2	0.958	Contact Map
3j01B	1	0.4241	4.1	0.96	Contact Map
4ib4A	1	0.2304	3.7	0.961	Contact Map
2mfrA	1	0.2775	3.1	0.962	Contact Map
4mqsA	1	0.2199	2.6	0.964	Contact Map
3w1oA	2	0.5497	2.6	0.964	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.