Spb1_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Spb1_C - Spb1 C-terminal domain

PFAM:	PF07780	Sequences: SEDDDDFEIVPAEEDDDSDDDDDDDEDDEDDDILTAEALALAHQLATRKKTKRDLIDDGFNRYAFNDKDGLPDWFLDDEKKHSKPQLPITKEAVAAIKEKLRALNARPIKKVAEAKARKKRRAAKRLEKAKKKAEAIADDEDMSEREKAKQIEKLYKKAAKKKKKPEVKYVVAKGGNRGIKGRPKGVKGRYKMVDPRMKKDLRAQKRKAK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	210 (207)
Sequences:	597 (431)
Seq/√Len:	29.9
META:	0.296

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
204_A	208_K	5.335	1.00
198_M	201_D	3.022	1.00
113_A	134_A	3.021	1.00
201_D	208_K	2.988	1.00
87_L	98_K	2.888	1.00
122_R	125_K	2.817	1.00
202_L	205_Q	2.782	1.00
40_A	45_L	2.746	1.00
121_R	125_K	2.607	1.00
137_I	155_L	2.558	0.99
25_D	28_D	2.477	0.99
204_A	207_R	2.174	0.98
35_T	38_A	2.160	0.98
197_R	201_D	2.157	0.98
7_F	10_V	2.154	0.98
200_K	204_A	2.113	0.98
19_D	22_D	2.103	0.98
201_D	204_A	2.083	0.98
113_A	117_A	2.068	0.98
154_K	158_K	2.016	0.97
197_R	200_K	1.930	0.96
135_E	139_D	1.918	0.96
198_M	202_L	1.821	0.95
83_S	147_E	1.799	0.95
44_Q	93_A	1.795	0.94
200_K	206_K	1.794	0.94
95_A	99_E	1.727	0.93
31_D	34_L	1.711	0.93
170_Y	202_L	1.701	0.93
44_Q	51_T	1.691	0.92
7_F	11_P	1.688	0.92
43_H	93_A	1.678	0.92
31_D	36_A	1.672	0.92
89_I	188_K	1.663	0.92
89_I	94_V	1.657	0.92
45_L	60_F	1.648	0.91
43_H	46_A	1.645	0.91
90_T	93_A	1.632	0.91
196_P	200_K	1.628	0.91
122_R	150_K	1.576	0.89
20_D	23_D	1.572	0.89
179_G	191_Y	1.554	0.89
50_K	54_D	1.523	0.88
96_A	99_E	1.516	0.88
45_L	51_T	1.500	0.87
205_Q	208_K	1.471	0.86
194_V	199_K	1.448	0.85
62_R	157_K	1.440	0.85
26_E	29_E	1.437	0.85
45_L	55_L	1.430	0.84
66_N	71_L	1.428	0.84
44_Q	49_K	1.407	0.83
17_D	20_D	1.405	0.83
39_L	100_K	1.396	0.83
178_R	181_K	1.392	0.83
15_D	22_D	1.353	0.81
130_A	155_L	1.332	0.80
99_E	103_A	1.326	0.79
8_E	14_E	1.321	0.79
169_K	193_M	1.316	0.79
22_D	25_D	1.314	0.79
102_R	137_I	1.309	0.78
18_S	21_D	1.299	0.78
173_A	184_P	1.283	0.77
23_D	56_I	1.274	0.77
184_P	191_Y	1.269	0.76
167_E	170_Y	1.268	0.76
78_D	81_K	1.255	0.75
15_D	18_S	1.226	0.74
88_P	108_P	1.225	0.74
23_D	28_D	1.219	0.73
192_K	202_L	1.218	0.73
187_V	191_Y	1.199	0.72
202_L	209_A	1.193	0.72
90_T	107_R	1.192	0.72
117_A	154_K	1.192	0.72
159_A	201_D	1.191	0.71
62_R	66_N	1.187	0.71
24_D	28_D	1.176	0.70
196_P	199_K	1.167	0.70
32_D	45_L	1.134	0.68
6_D	9_I	1.130	0.67
178_R	191_Y	1.118	0.67
81_K	205_Q	1.108	0.66
195_D	201_D	1.103	0.65
138_A	152_I	1.102	0.65
94_V	97_I	1.092	0.65
20_D	24_D	1.089	0.64
13_E	25_D	1.075	0.63
107_R	155_L	1.067	0.63
7_F	16_D	1.043	0.61
13_E	16_D	1.039	0.61
144_S	147_E	1.038	0.61
55_L	156_Y	1.036	0.61
135_E	201_D	1.035	0.60
140_D	147_E	1.030	0.60
15_D	20_D	1.025	0.60
13_E	17_D	1.022	0.59
51_T	55_L	1.018	0.59
16_D	27_D	1.017	0.59
13_E	19_D	1.011	0.59
23_D	27_D	0.996	0.57
173_A	183_R	0.989	0.57
17_D	22_D	0.982	0.56
93_A	96_A	0.981	0.56
23_D	26_E	0.981	0.56
52_K	63_Y	0.980	0.56
49_K	56_I	0.976	0.56
47_T	52_K	0.970	0.55
56_I	160_A	0.963	0.55
94_V	112_V	0.960	0.55
178_R	196_P	0.947	0.54
42_A	97_I	0.945	0.53
123_A	182_G	0.944	0.53
173_A	193_M	0.943	0.53
113_A	142_D	0.940	0.53
65_F	125_K	0.935	0.53
173_A	186_G	0.934	0.53
37_E	81_K	0.929	0.52
128_E	131_K	0.925	0.52
42_A	96_A	0.915	0.51
63_Y	83_S	0.913	0.51
9_I	15_D	0.909	0.51
10_V	15_D	0.903	0.50
45_L	50_K	0.890	0.49
14_E	18_S	0.890	0.49
11_P	14_E	0.882	0.48
193_M	201_D	0.873	0.48
153_E	192_K	0.872	0.48
142_D	162_K	0.871	0.48
6_D	10_V	0.863	0.47
140_D	153_E	0.862	0.47
9_I	18_S	0.861	0.47
186_G	191_Y	0.858	0.47
100_K	152_I	0.856	0.46
183_R	187_V	0.853	0.46
21_D	26_E	0.844	0.45
71_L	76_L	0.841	0.45
178_R	182_G	0.840	0.45
84_K	102_R	0.839	0.45
36_A	58_D	0.838	0.45
12_A	16_D	0.835	0.45
66_N	83_S	0.834	0.45
56_I	59_G	0.829	0.44
24_D	163_K	0.826	0.44
183_R	186_G	0.822	0.44
87_L	167_E	0.821	0.44
63_Y	66_N	0.819	0.44
64_A	164_K	0.817	0.43
174_K	182_G	0.816	0.43
107_R	119_K	0.815	0.43
173_A	189_G	0.814	0.43
16_D	21_D	0.813	0.43
32_D	98_K	0.812	0.43
59_G	65_F	0.807	0.43
131_K	139_D	0.804	0.42
176_G	201_D	0.801	0.42
99_E	102_R	0.797	0.42
5_D	16_D	0.793	0.41
143_M	197_R	0.789	0.41
73_D	85_P	0.788	0.41
48_R	85_P	0.788	0.41
112_V	138_A	0.784	0.41
59_G	166_P	0.784	0.41
190_R	193_M	0.782	0.41
43_H	151_Q	0.782	0.41
43_H	47_T	0.779	0.40
156_Y	181_K	0.776	0.40
48_R	97_I	0.775	0.40
56_I	60_F	0.774	0.40
66_N	134_A	0.770	0.40
162_K	205_Q	0.768	0.40
40_A	170_Y	0.768	0.40
55_L	104_L	0.761	0.39
41_L	141_E	0.760	0.39
151_Q	156_Y	0.754	0.39
95_A	129_K	0.753	0.38
39_L	175_G	0.753	0.38
97_I	130_A	0.750	0.38
24_D	27_D	0.747	0.38
23_D	155_L	0.745	0.38
183_R	191_Y	0.742	0.38
184_P	187_V	0.742	0.38
106_A	113_A	0.739	0.37
206_K	210_K	0.735	0.37
82_H	145_E	0.728	0.37
19_D	25_D	0.728	0.37
126_R	143_M	0.724	0.36
197_R	202_L	0.724	0.36
138_A	201_D	0.721	0.36
15_D	21_D	0.720	0.36
42_A	175_G	0.717	0.36
33_I	36_A	0.715	0.36
9_I	12_A	0.712	0.35
30_D	34_L	0.712	0.35
143_M	150_K	0.708	0.35
16_D	26_E	0.708	0.35
16_D	22_D	0.706	0.35
11_P	21_D	0.702	0.35
91_K	104_L	0.702	0.35
83_S	87_L	0.701	0.35
90_T	102_R	0.698	0.34
165_K	170_Y	0.694	0.34
4_D	15_D	0.692	0.34
116_K	174_K	0.692	0.34
116_K	151_Q	0.692	0.34
33_I	47_T	0.691	0.34
95_A	141_E	0.689	0.34
21_D	25_D	0.687	0.34
196_P	202_L	0.682	0.33
60_F	116_K	0.678	0.33
65_F	83_S	0.677	0.33
16_D	24_D	0.677	0.33
174_K	178_R	0.676	0.33
68_K	87_L	0.673	0.33
64_A	83_S	0.673	0.33
154_K	190_R	0.670	0.32
113_A	130_A	0.668	0.32
64_A	108_P	0.666	0.32
32_D	35_T	0.664	0.32
91_K	129_K	0.662	0.32
7_F	15_D	0.662	0.32
104_L	131_K	0.660	0.32
53_R	57_D	0.656	0.31
69_D	199_K	0.655	0.31
10_V	18_S	0.654	0.31
59_G	86_Q	0.654	0.31
49_K	64_A	0.648	0.31
12_A	17_D	0.646	0.31
46_A	59_G	0.646	0.31
40_A	50_K	0.644	0.31
17_D	23_D	0.644	0.31
18_S	28_D	0.643	0.31
9_I	62_R	0.641	0.30
13_E	24_D	0.641	0.30
57_D	60_F	0.641	0.30
16_D	19_D	0.634	0.30
101_L	149_A	0.633	0.30
74_W	115_A	0.632	0.30
20_D	26_E	0.631	0.30
13_E	29_E	0.630	0.30
204_A	210_K	0.629	0.30
54_D	65_F	0.628	0.30
151_Q	155_L	0.628	0.30
55_L	122_R	0.628	0.30
117_A	121_R	0.625	0.29
27_D	78_D	0.622	0.29
103_A	108_P	0.622	0.29
13_E	22_D	0.622	0.29
161_K	192_K	0.618	0.29
65_F	131_K	0.617	0.29
44_Q	50_K	0.615	0.29
131_K	155_L	0.612	0.29
146_R	150_K	0.610	0.28
32_D	47_T	0.610	0.28
184_P	189_G	0.609	0.28
89_I	142_D	0.609	0.28
39_L	43_H	0.608	0.28
37_E	159_A	0.608	0.28
175_G	178_R	0.606	0.28
45_L	167_E	0.603	0.28
16_D	20_D	0.596	0.28
143_M	151_Q	0.595	0.27
96_A	185_K	0.595	0.27
100_K	109_I	0.594	0.27
202_L	206_K	0.586	0.27
40_A	43_H	0.585	0.27
101_L	139_D	0.582	0.27
173_A	191_Y	0.577	0.26
63_Y	167_E	0.575	0.26
50_K	152_I	0.569	0.26
20_D	25_D	0.567	0.26
73_D	156_Y	0.562	0.25
176_G	202_L	0.559	0.25
131_K	138_A	0.555	0.25
144_S	174_K	0.554	0.25
136_A	142_D	0.553	0.25
7_F	12_A	0.552	0.25
56_I	62_R	0.550	0.25
18_S	26_E	0.549	0.25
21_D	28_D	0.547	0.25
173_A	187_V	0.546	0.24
55_L	135_E	0.545	0.24
165_K	168_V	0.545	0.24
54_D	129_K	0.541	0.24
120_K	136_A	0.539	0.24
49_K	59_G	0.534	0.24
170_Y	193_M	0.532	0.24
84_K	129_K	0.531	0.24
110_K	175_G	0.526	0.23
120_K	198_M	0.524	0.23
99_E	145_E	0.523	0.23
91_K	102_R	0.523	0.23
48_R	94_V	0.518	0.23
8_E	15_D	0.518	0.23
8_E	11_P	0.518	0.23
48_R	140_D	0.518	0.23
64_A	85_P	0.515	0.23
101_L	174_K	0.515	0.23
141_E	198_M	0.513	0.23
54_D	99_E	0.513	0.23
177_N	204_A	0.510	0.22
22_D	26_E	0.509	0.22
177_N	192_K	0.508	0.22
55_L	200_K	0.507	0.22
169_K	186_G	0.507	0.22
95_A	185_K	0.506	0.22
65_F	137_I	0.505	0.22
177_N	186_G	0.500	0.22
169_K	187_V	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4gyiA	1	0.0286	15.4	0.96	Contact Map
4fp9B	2	0.0286	10.8	0.962	Contact Map
2marA	1	0.5286	5.4	0.967	Contact Map
1ya0A	1	0.2857	2.2	0.973	Contact Map
3e1kB	1	0.0667	2.1	0.973	Contact Map
4ui9I	1	0.1095	1.9	0.974	Contact Map
1i27A	1	0.3429	1.9	0.974	Contact Map
1wglA	1	0.281	1.9	0.974	Contact Map
2n0pA	1	0.3667	1.8	0.974	Contact Map
1a0cA	4	0.3048	1.8	0.974	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.