DUF1618 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1618 - Protein of unknown function (DUF1618)

PFAM:	PF07762	Sequences: WVDLWRGILLCELRFVPLPPPYRDVAVSDIKFVEISDPEWTVTTWTLSPDPSSGEWRKDCTTVDVADIWAAGLPRLLPLVPAFPTLHSLDDPDVVY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	96 (92)
Sequences:	904 (752)
Seq/√Len:	78.4
META:	0.046

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
73_L	77_L	3.560	1.00
71_A	74_P	3.135	1.00
84_P	88_S	2.879	1.00
73_L	76_L	2.560	1.00
25_V	28_S	2.527	1.00
30_I	63_V	2.350	1.00
73_L	78_P	2.258	1.00
72_G	75_R	2.200	1.00
74_P	77_L	1.878	1.00
6_R	11_C	1.866	1.00
12_E	36_S	1.783	1.00
46_T	59_D	1.761	1.00
15_F	21_P	1.747	1.00
69_W	81_P	1.736	1.00
76_L	79_L	1.689	1.00
24_D	85_T	1.659	1.00
27_V	32_F	1.612	1.00
4_L	45_W	1.571	0.99
20_P	51_P	1.561	0.99
42_V	45_W	1.542	0.99
70_A	75_R	1.535	0.99
48_S	59_D	1.495	0.99
58_K	62_T	1.490	0.99
36_S	39_E	1.481	0.99
5_W	8_I	1.465	0.99
40_W	44_T	1.447	0.99
6_R	13_L	1.375	0.99
10_L	14_R	1.345	0.98
31_K	92_P	1.298	0.98
44_T	60_C	1.240	0.97
41_T	46_T	1.237	0.97
27_V	31_K	1.217	0.97
24_D	34_E	1.164	0.96
30_I	34_E	1.158	0.96
5_W	96_Y	1.153	0.96
82_A	85_T	1.149	0.96
85_T	88_S	1.136	0.96
18_L	95_V	1.130	0.95
42_V	47_L	1.112	0.95
63_V	68_I	1.088	0.94
2_V	25_V	1.087	0.94
31_K	59_D	1.085	0.94
71_A	75_R	1.083	0.94
53_S	57_R	1.065	0.94
62_T	66_A	1.062	0.94
33_V	39_E	1.056	0.93
41_T	66_A	1.055	0.93
85_T	96_Y	1.055	0.93
78_P	81_P	1.049	0.93
7_G	15_F	1.038	0.93
25_V	83_F	1.034	0.93
2_V	8_I	0.989	0.91
48_S	60_C	0.982	0.91
40_W	43_T	0.969	0.90
74_P	78_P	0.964	0.90
55_E	86_L	0.943	0.89
3_D	83_F	0.932	0.88
42_V	92_P	0.892	0.86
58_K	93_D	0.890	0.86
17_P	44_T	0.886	0.85
59_D	93_D	0.855	0.83
46_T	90_D	0.847	0.83
63_V	67_D	0.845	0.83
29_D	96_Y	0.830	0.82
28_S	34_E	0.828	0.81
18_L	35_I	0.827	0.81
4_L	83_F	0.823	0.81
86_L	92_P	0.819	0.81
27_V	86_L	0.809	0.80
27_V	91_D	0.798	0.79
15_F	47_L	0.797	0.79
25_V	34_E	0.790	0.78
30_I	92_P	0.789	0.78
3_D	7_G	0.783	0.78
47_L	54_G	0.762	0.76
10_L	35_I	0.748	0.74
35_I	40_W	0.727	0.72
11_C	94_V	0.725	0.72
41_T	67_D	0.715	0.71
5_W	15_F	0.708	0.70
72_G	76_L	0.700	0.69
1_W	31_K	0.699	0.69
6_R	12_E	0.691	0.68
71_A	80_V	0.690	0.68
39_E	64_D	0.685	0.68
4_L	66_A	0.684	0.68
26_A	29_D	0.680	0.67
4_L	8_I	0.680	0.67
45_W	56_W	0.678	0.67
13_L	60_C	0.672	0.66
33_V	86_L	0.671	0.66
8_I	44_T	0.668	0.66
8_I	82_A	0.664	0.65
14_R	67_D	0.659	0.65
28_S	31_K	0.645	0.63
8_I	39_E	0.645	0.63
11_C	89_L	0.640	0.62
23_R	34_E	0.640	0.62
15_F	30_I	0.638	0.62
65_V	81_P	0.629	0.61
68_I	83_F	0.627	0.61
4_L	11_C	0.613	0.59
12_E	51_P	0.611	0.59
52_S	70_A	0.610	0.59
5_W	21_P	0.609	0.59
39_E	47_L	0.598	0.57
82_A	90_D	0.598	0.57
14_R	54_G	0.593	0.57
16_V	65_V	0.593	0.57
4_L	92_P	0.590	0.56
71_A	76_L	0.579	0.55
69_W	82_A	0.577	0.55
32_F	42_V	0.575	0.54
36_S	82_A	0.574	0.54
41_T	47_L	0.564	0.53
22_Y	84_P	0.560	0.52
68_I	94_V	0.557	0.52
43_T	62_T	0.556	0.52
20_P	43_T	0.555	0.52
8_I	52_S	0.555	0.52
48_S	57_R	0.553	0.52
66_A	70_A	0.552	0.51
75_R	78_P	0.543	0.50
20_P	41_T	0.539	0.50
20_P	65_V	0.532	0.49
24_D	35_I	0.532	0.49
6_R	10_L	0.530	0.49
8_I	25_V	0.526	0.48
82_A	91_D	0.525	0.48
12_E	69_W	0.524	0.48
4_L	13_L	0.523	0.48
39_E	66_A	0.518	0.47
3_D	23_R	0.515	0.47
15_F	26_A	0.503	0.45
79_L	95_V	0.503	0.45
26_A	66_A	0.501	0.45
57_R	64_D	0.501	0.45
67_D	75_R	0.500	0.45

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2olmA	2	0.7812	7	0.915	Contact Map
3ljuX	1	0.7708	5	0.921	Contact Map
2iqjA	1	0.8021	4.6	0.922	Contact Map
3jueA	1	0.8125	4.5	0.922	Contact Map
2crrA	1	0.7917	4.1	0.924	Contact Map
4fg0A	3	0.7396	3.3	0.927	Contact Map
3p54A	3	0.75	3.1	0.928	Contact Map
3lvqE	1	0.8125	2.6	0.931	Contact Map
3hy0A	1	0.3958	2.5	0.932	Contact Map
4ohxA	1	0.3125	2.1	0.935	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.