Abi_2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Abi_2 - Abi-like protein

PFAM:	PF07751	Sequences: EYLSNINYYRLSGYWYPFRKKRDHKFKGTTFEDILALYEFDRELRLLLLDAIERIEVALRTKIAYHLSKYGPFWYLDPSNFNNKFKHKKNVKKLLEKIKKEIKRSKEDFIKHYKNKYPGYPPIWVLVEVLSFGTLSKLYSNLKDKDKKAIAKEFGLLESWLHSLNYLRNICAHHSRLWN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	179 (176)
Sequences:	8372 (6695)
Seq/√Len:	504.6
META:	0.798

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
2_Y	35_L	2.882	1.00
62_K	153_E	2.808	1.00
68_S	123_I	2.782	1.00
30_T	33_D	2.643	1.00
136_S	165_N	2.414	1.00
20_K	25_K	2.232	1.00
170_I	175_S	2.102	1.00
170_I	177_L	2.069	1.00
15_W	26_F	2.058	1.00
140_S	158_E	2.042	1.00
142_L	146_D	1.995	1.00
59_L	161_L	1.961	1.00
15_W	34_I	1.932	1.00
35_L	39_E	1.874	1.00
66_H	149_A	1.848	1.00
2_Y	6_I	1.848	1.00
58_A	154_F	1.843	1.00
101_E	104_R	1.792	1.00
46_L	50_D	1.766	1.00
162_H	165_N	1.748	1.00
42_R	54_R	1.742	1.00
19_R	24_H	1.720	1.00
60_R	135_L	1.672	1.00
136_S	162_H	1.661	1.00
113_Y	125_V	1.654	1.00
42_R	53_E	1.646	1.00
62_K	66_H	1.625	1.00
5_N	58_A	1.602	1.00
11_L	15_W	1.578	1.00
48_L	177_L	1.549	1.00
122_P	125_V	1.535	1.00
97_K	100_K	1.528	1.00
52_I	164_L	1.523	1.00
64_A	127_V	1.510	1.00
6_I	35_L	1.497	1.00
64_A	68_S	1.492	1.00
66_H	153_E	1.472	1.00
147_K	158_E	1.452	1.00
101_E	134_T	1.438	1.00
49_L	53_E	1.438	1.00
109_F	129_V	1.430	1.00
139_Y	147_K	1.427	1.00
130_L	134_T	1.425	1.00
16_Y	19_R	1.424	1.00
71_G	77_D	1.412	1.00
49_L	171_C	1.404	1.00
167_L	177_L	1.401	1.00
139_Y	161_L	1.394	1.00
111_K	115_N	1.381	1.00
36_A	39_E	1.381	1.00
33_D	36_A	1.350	1.00
131_S	134_T	1.343	1.00
162_H	166_Y	1.337	1.00
29_T	34_I	1.308	1.00
97_K	134_T	1.307	1.00
4_S	153_E	1.286	1.00
75_Y	126_L	1.286	1.00
140_S	162_H	1.281	1.00
74_W	123_I	1.274	1.00
70_Y	146_D	1.264	1.00
18_F	29_T	1.263	1.00
42_R	50_D	1.258	1.00
97_K	101_E	1.255	1.00
63_I	139_Y	1.245	1.00
127_V	135_L	1.229	1.00
50_D	54_R	1.211	1.00
7_N	10_R	1.210	1.00
98_I	126_L	1.210	1.00
166_Y	170_I	1.209	1.00
136_S	161_L	1.206	1.00
98_I	102_I	1.200	1.00
2_Y	11_L	1.198	1.00
39_E	42_R	1.178	1.00
139_Y	158_E	1.173	1.00
43_E	50_D	1.166	1.00
96_E	100_K	1.164	1.00
130_L	135_L	1.163	1.00
10_R	57_V	1.149	1.00
132_F	165_N	1.143	1.00
127_V	130_L	1.135	1.00
87_H	90_N	1.130	1.00
57_V	60_R	1.130	1.00
20_K	23_D	1.120	1.00
73_F	113_Y	1.114	1.00
126_L	130_L	1.108	1.00
38_Y	57_V	1.105	1.00
94_L	98_I	1.090	1.00
100_K	104_R	1.088	1.00
20_K	27_K	1.088	1.00
53_E	174_H	1.087	1.00
45_R	171_C	1.086	1.00
76_L	120_Y	1.083	1.00
13_G	16_Y	1.058	1.00
71_G	74_W	1.051	1.00
95_L	99_K	1.049	1.00
52_I	171_C	1.043	1.00
73_F	76_L	1.040	1.00
74_W	80_N	1.038	1.00
113_Y	118_P	1.029	1.00
67_L	123_I	1.016	1.00
137_K	165_N	1.009	1.00
58_A	62_K	0.996	1.00
59_L	135_L	0.994	1.00
99_K	103_K	0.976	1.00
49_L	52_I	0.974	1.00
77_D	80_N	0.972	1.00
110_I	121_P	0.967	1.00
49_L	172_A	0.962	1.00
137_K	140_S	0.956	1.00
47_L	51_A	0.955	1.00
32_E	36_A	0.946	1.00
143_K	146_D	0.943	1.00
110_I	129_V	0.941	1.00
7_N	127_V	0.940	1.00
63_I	142_L	0.940	1.00
39_E	43_E	0.934	1.00
76_L	99_K	0.933	1.00
73_F	120_Y	0.931	1.00
144_D	148_K	0.917	1.00
124_W	128_E	0.907	1.00
110_I	113_Y	0.906	1.00
151_A	157_L	0.905	1.00
51_A	54_R	0.904	1.00
2_Y	39_E	0.903	1.00
134_T	137_K	0.900	1.00
136_S	158_E	0.899	1.00
122_P	128_E	0.898	1.00
66_H	69_K	0.897	1.00
67_L	146_D	0.892	1.00
109_F	113_Y	0.891	1.00
96_E	99_K	0.890	1.00
12_S	19_R	0.886	1.00
139_Y	150_I	0.881	1.00
163_S	167_L	0.879	1.00
174_H	178_W	0.877	1.00
61_T	65_Y	0.873	1.00
67_L	80_N	0.859	1.00
12_S	16_Y	0.853	1.00
134_T	138_L	0.853	1.00
7_N	61_T	0.852	1.00
12_S	15_W	0.851	1.00
48_L	171_C	0.851	1.00
4_S	62_K	0.851	1.00
18_F	34_I	0.849	1.00
146_D	149_A	0.846	1.00
99_K	120_Y	0.845	1.00
62_K	154_F	0.845	1.00
145_K	149_A	0.842	1.00
147_K	151_A	0.835	1.00
168_R	173_H	0.830	1.00
64_A	123_I	0.828	1.00
41_D	45_R	0.828	1.00
85_F	141_N	0.821	1.00
15_W	19_R	0.820	1.00
65_Y	68_S	0.812	1.00
59_L	139_Y	0.793	1.00
69_K	149_A	0.777	1.00
108_D	111_K	0.773	1.00
13_G	17_P	0.769	1.00
128_E	175_S	0.769	1.00
60_R	174_H	0.765	1.00
130_L	138_L	0.765	1.00
83_N	87_H	0.760	1.00
163_S	166_Y	0.757	1.00
6_I	11_L	0.757	1.00
33_D	37_L	0.750	1.00
62_K	65_Y	0.746	1.00
10_R	128_E	0.738	1.00
66_H	146_D	0.727	1.00
82_N	85_F	0.722	1.00
169_N	173_H	0.713	1.00
2_Y	5_N	0.712	1.00
98_I	130_L	0.711	1.00
159_S	163_S	0.709	1.00
102_I	110_I	0.705	1.00
12_S	24_H	0.704	1.00
149_A	153_E	0.698	1.00
102_I	105_S	0.694	1.00
83_N	86_K	0.693	1.00
42_R	46_L	0.689	1.00
5_N	62_K	0.682	1.00
4_S	65_Y	0.682	1.00
160_W	163_S	0.680	1.00
113_Y	117_Y	0.678	1.00
112_H	116_K	0.678	1.00
75_Y	120_Y	0.676	1.00
136_S	140_S	0.674	1.00
111_K	114_K	0.671	1.00
142_L	150_I	0.668	1.00
102_I	114_K	0.666	1.00
113_Y	122_P	0.665	1.00
9_Y	13_G	0.661	1.00
144_D	147_K	0.660	1.00
63_I	138_L	0.657	1.00
11_L	35_L	0.654	1.00
22_R	25_K	0.653	1.00
19_R	22_R	0.648	1.00
148_K	152_K	0.646	1.00
47_L	50_D	0.644	1.00
78_P	84_K	0.643	1.00
109_F	125_V	0.639	1.00
123_I	128_E	0.635	1.00
63_I	135_L	0.631	1.00
78_P	88_K	0.631	1.00
99_K	102_I	0.630	1.00
98_I	101_E	0.626	1.00
90_N	94_L	0.625	1.00
151_A	154_F	0.620	1.00
32_E	35_L	0.620	1.00
74_W	81_F	0.618	1.00
128_E	135_L	0.616	1.00
19_R	23_D	0.616	1.00
74_W	77_D	0.611	1.00
67_L	138_L	0.608	1.00
101_E	131_S	0.605	0.99
46_L	53_E	0.604	0.99
139_Y	151_A	0.603	0.99
176_R	179_N	0.597	0.99
112_H	124_W	0.597	0.99
18_F	37_L	0.592	0.99
46_L	49_L	0.590	0.99
55_I	59_L	0.588	0.99
36_A	40_F	0.588	0.99
97_K	104_R	0.588	0.99
89_K	93_K	0.582	0.99
6_I	38_Y	0.581	0.99
110_I	114_K	0.580	0.99
67_L	142_L	0.574	0.99
125_V	128_E	0.573	0.99
86_K	90_N	0.572	0.99
67_L	74_W	0.571	0.99
40_F	178_W	0.569	0.99
4_S	61_T	0.568	0.99
161_L	165_N	0.562	0.99
19_R	25_K	0.561	0.99
157_L	161_L	0.560	0.99
69_K	145_K	0.560	0.99
10_R	38_Y	0.555	0.99
121_P	126_L	0.554	0.99
105_S	114_K	0.554	0.99
50_D	53_E	0.546	0.99
6_I	10_R	0.546	0.99
109_F	128_E	0.545	0.99
131_S	165_N	0.543	0.99
150_I	154_F	0.541	0.99
99_K	119_G	0.540	0.99
103_K	106_K	0.535	0.99
123_I	127_V	0.533	0.99
73_F	118_P	0.530	0.99
95_L	98_I	0.530	0.99
43_E	47_L	0.529	0.99
135_L	138_L	0.529	0.99
112_H	117_Y	0.522	0.98
102_I	126_L	0.521	0.98
40_F	44_L	0.520	0.98
34_I	37_L	0.519	0.98
85_F	88_K	0.519	0.98
18_F	33_D	0.517	0.98
126_L	135_L	0.516	0.98
29_T	33_D	0.511	0.98
93_K	97_K	0.508	0.98
19_R	26_F	0.504	0.98
16_Y	108_D	0.503	0.98
88_K	99_K	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2b6gA	1	0.3687	4.4	0.937	Contact Map
3hilA	1	0.2905	3.8	0.939	Contact Map
3kkaC	1	0.3184	3.8	0.939	Contact Map
1regX	2	0.4581	3.8	0.94	Contact Map
2es6A	1	0.3687	3.3	0.941	Contact Map
3h8mA	1	0.324	3.1	0.942	Contact Map
2ksoA	1	0.3296	3.1	0.942	Contact Map
1ucvA	1	0.3743	3.1	0.942	Contact Map
2d3dA	1	0.3687	2.7	0.944	Contact Map
2k4pA	1	0.2961	2.7	0.944	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.