FBA_2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FBA_2 - F-box associated

PFAM:	PF07735	Sequences: EFQKILIQNFDSLSIGSFITLDDLLLMNCKTIELENSSLTNKDLNRFLKHWIAGSNPRLEYLSI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	64 (61)
Sequences:	1229 (1012)
Seq/√Len:	129.5
META:	0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
45_N	49_K	5.159	1.00
50_H	55_S	2.805	1.00
54_G	57_P	2.753	1.00
47_F	56_N	2.462	1.00
24_L	47_F	2.321	1.00
4_K	7_I	2.037	1.00
30_K	58_R	1.806	1.00
8_Q	13_L	1.799	1.00
46_R	50_H	1.774	1.00
52_I	56_N	1.669	1.00
29_C	32_I	1.614	1.00
27_M	32_I	1.606	1.00
17_S	37_S	1.588	1.00
43_D	46_R	1.342	1.00
33_E	61_Y	1.318	1.00
23_D	41_N	1.308	1.00
13_L	27_M	1.294	1.00
31_T	61_Y	1.235	1.00
28_N	64_I	1.220	1.00
47_F	55_S	1.217	1.00
41_N	48_L	1.213	0.99
19_I	27_M	1.204	0.99
5_I	17_S	1.203	0.99
30_K	60_E	1.147	0.99
12_S	33_E	1.118	0.99
37_S	64_I	1.092	0.99
19_I	40_T	1.086	0.99
14_S	33_E	1.055	0.99
31_T	52_I	1.036	0.98
38_S	42_K	1.024	0.98
9_N	28_N	1.008	0.98
30_K	49_K	1.003	0.98
18_F	35_E	0.954	0.97
6_L	26_L	0.937	0.97
28_N	47_F	0.909	0.96
16_G	35_E	0.886	0.96
23_D	28_N	0.847	0.95
51_W	61_Y	0.843	0.94
21_L	25_L	0.827	0.94
53_A	57_P	0.826	0.94
32_I	36_N	0.825	0.94
5_I	43_D	0.818	0.93
24_L	36_N	0.817	0.93
43_D	64_I	0.817	0.93
16_G	38_S	0.806	0.93
21_L	30_K	0.793	0.92
45_N	56_N	0.780	0.92
12_S	30_K	0.775	0.92
15_I	32_I	0.762	0.91
26_L	31_T	0.751	0.90
49_K	56_N	0.741	0.90
44_L	63_S	0.733	0.89
41_N	55_S	0.726	0.89
9_N	26_L	0.720	0.88
28_N	58_R	0.718	0.88
10_F	13_L	0.709	0.87
50_H	58_R	0.702	0.87
5_I	48_L	0.700	0.87
4_K	34_L	0.700	0.87
26_L	38_S	0.675	0.85
15_I	59_L	0.661	0.84
11_D	58_R	0.655	0.83
32_I	54_G	0.654	0.83
18_F	38_S	0.647	0.82
22_D	46_R	0.637	0.81
7_I	46_R	0.634	0.81
12_S	15_I	0.622	0.80
19_I	39_L	0.620	0.80
24_L	62_L	0.619	0.79
39_L	43_D	0.612	0.79
10_F	29_C	0.607	0.78
46_R	61_Y	0.604	0.78
18_F	33_E	0.601	0.77
30_K	46_R	0.591	0.76
30_K	62_L	0.575	0.74
6_L	27_M	0.567	0.73
8_Q	42_K	0.562	0.73
21_L	38_S	0.557	0.72
12_S	52_I	0.553	0.71
41_N	46_R	0.543	0.70
19_I	46_R	0.542	0.70
20_T	23_D	0.541	0.70
11_D	14_S	0.538	0.69
21_L	59_L	0.535	0.69
31_T	63_S	0.534	0.69
42_K	60_E	0.526	0.68
4_K	48_L	0.519	0.67
60_E	63_S	0.515	0.66
16_G	36_N	0.508	0.65
35_E	64_I	0.504	0.64
26_L	60_E	0.504	0.64
35_E	38_S	0.500	0.64

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4kxfK	4	1	8.1	0.856	Contact Map
4pq8A	1	0.9688	7.6	0.858	Contact Map
2ra8A	2	1	6.9	0.861	Contact Map
1m9sA	1	0.8438	6.3	0.863	Contact Map
4r5cA	1	0.9375	5.8	0.866	Contact Map
4r6gA	1	0.9688	5.2	0.868	Contact Map
4r5dA	1	0.9375	4.8	0.87	Contact Map
1h6tA	1	0.8438	4.5	0.873	Contact Map
4fkeA	1	0.9688	4.2	0.874	Contact Map
4wz9A	2	0.9844	4.2	0.874	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.