Secretin_N_2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Secretin_N_2 - Secretin N-terminal domain

PFAM:	PF07655	Sequences: TRTFQVNYLNGQRSGTSDTRVSSGSVSSSGSGGGGGGGGGGSSGSSGGSGGGSNSSSGSRISTTSESDFWKELEKALKAILGSGDGRSVVVSPQA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	95 (93)
Sequences:	4878 (4012)
Seq/√Len:	416.0
META:	0.886

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
74_E	78_K	5.838	1.00
68_D	71_K	3.883	1.00
12_Q	66_E	3.331	1.00
12_Q	68_D	2.664	1.00
14_S	66_E	2.619	1.00
16_T	62_S	2.399	1.00
14_S	62_S	2.123	1.00
23_S	26_V	1.972	1.00
18_D	60_R	1.957	1.00
6_V	73_L	1.898	1.00
8_Y	13_R	1.758	1.00
82_G	87_R	1.709	1.00
17_S	21_V	1.640	1.00
6_V	69_F	1.587	1.00
12_Q	64_T	1.573	1.00
10_N	67_S	1.562	1.00
40_G	43_S	1.530	1.00
71_K	75_K	1.398	1.00
37_G	40_G	1.384	1.00
36_G	39_G	1.377	1.00
33_G	36_G	1.357	1.00
16_T	60_R	1.348	1.00
88_S	91_V	1.295	1.00
5_Q	11_G	1.287	1.00
75_K	78_K	1.252	1.00
72_E	76_A	1.224	1.00
20_R	23_S	1.223	1.00
71_K	74_E	1.182	1.00
53_S	56_S	1.144	1.00
11_G	65_S	1.125	1.00
7_N	13_R	1.124	1.00
7_N	11_G	1.098	1.00
47_G	51_G	1.094	1.00
79_A	82_G	1.090	1.00
57_S	60_R	1.085	1.00
5_Q	67_S	1.067	1.00
21_V	24_G	1.058	1.00
13_R	61_I	1.046	1.00
74_E	91_V	1.035	1.00
25_S	57_S	1.032	1.00
3_T	19_T	1.028	1.00
41_G	49_S	1.027	1.00
77_L	82_G	1.026	1.00
11_G	19_T	1.025	1.00
19_T	61_I	1.021	1.00
58_G	63_T	0.997	1.00
10_N	66_E	0.955	1.00
78_K	83_S	0.950	1.00
39_G	43_S	0.948	1.00
31_S	35_G	0.925	1.00
35_G	38_G	0.925	1.00
49_S	52_G	0.922	1.00
45_S	52_G	0.919	1.00
34_G	40_G	0.915	1.00
32_G	38_G	0.911	1.00
43_S	47_G	0.906	1.00
38_G	43_S	0.892	1.00
69_F	73_L	0.887	1.00
49_S	54_N	0.881	1.00
38_G	41_G	0.876	1.00
76_A	79_A	0.851	1.00
8_Y	69_F	0.846	1.00
84_G	87_R	0.846	1.00
66_E	71_K	0.845	1.00
11_G	76_A	0.838	1.00
59_S	63_T	0.834	1.00
45_S	50_G	0.830	1.00
46_S	49_S	0.830	1.00
65_S	76_A	0.824	1.00
50_G	53_S	0.823	1.00
34_G	39_G	0.821	1.00
39_G	44_G	0.814	1.00
14_S	64_T	0.814	1.00
83_S	87_R	0.804	1.00
31_S	34_G	0.803	1.00
19_T	63_T	0.802	1.00
16_T	64_T	0.795	1.00
39_G	42_S	0.793	1.00
38_G	48_G	0.774	1.00
72_E	92_S	0.770	1.00
15_G	77_L	0.766	1.00
18_D	21_V	0.758	1.00
33_G	37_G	0.755	1.00
20_R	60_R	0.746	1.00
13_R	17_S	0.740	1.00
59_S	76_A	0.731	1.00
7_N	17_S	0.717	1.00
40_G	46_S	0.711	1.00
70_W	90_V	0.708	1.00
51_G	54_N	0.702	1.00
6_V	10_N	0.693	1.00
44_G	50_G	0.690	1.00
45_S	49_S	0.677	1.00
13_R	70_W	0.673	1.00
48_G	51_G	0.667	0.99
42_S	45_S	0.664	0.99
39_G	50_G	0.661	0.99
14_S	68_D	0.660	0.99
46_S	50_G	0.657	0.99
52_G	55_S	0.656	0.99
25_S	28_S	0.646	0.99
36_G	49_S	0.643	0.99
57_S	62_S	0.640	0.99
23_S	59_S	0.639	0.99
10_N	65_S	0.638	0.99
19_T	58_G	0.634	0.99
35_G	49_S	0.630	0.99
19_T	24_G	0.628	0.99
36_G	40_G	0.622	0.99
35_G	39_G	0.616	0.99
7_N	19_T	0.615	0.99
48_G	52_G	0.615	0.99
58_G	67_S	0.615	0.99
25_S	59_S	0.613	0.99
69_F	92_S	0.612	0.99
41_G	48_G	0.609	0.99
59_S	67_S	0.608	0.99
30_G	33_G	0.600	0.99
4_F	10_N	0.594	0.99
82_G	86_G	0.587	0.99
42_S	50_G	0.586	0.99
24_G	27_S	0.574	0.98
13_R	59_S	0.567	0.98
32_G	36_G	0.566	0.98
88_S	92_S	0.565	0.98
45_S	53_S	0.563	0.98
41_G	46_S	0.561	0.98
15_G	21_V	0.558	0.98
2_R	5_Q	0.557	0.98
10_N	25_S	0.547	0.98
67_S	76_A	0.544	0.98
61_I	70_W	0.544	0.98
4_F	67_S	0.543	0.98
37_G	42_S	0.532	0.97
37_G	43_S	0.525	0.97
25_S	58_G	0.523	0.97
8_Y	61_I	0.522	0.97
10_N	80_I	0.519	0.97
51_G	56_S	0.512	0.97
47_G	50_G	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ossD	1	0.5053	38.7	0.837	Contact Map
4kblA	2	0.3474	13.4	0.869	Contact Map
4e9jA	2	0.7474	11.7	0.873	Contact Map
4ladB	1	0.2947	8.3	0.881	Contact Map
3gr5A	2	0.6947	6.2	0.888	Contact Map
4av2A	3	0.7789	6.1	0.889	Contact Map
4g08A	1	0.6842	4.2	0.897	Contact Map
1o4yA	1	0.1789	2.9	0.905	Contact Map
4rxuA	1	0.4316	2.7	0.906	Contact Map
1wj6A	1	0.5368	2.6	0.907	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.