DUF1598 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1598 - Protein of unknown function (DUF1598)

PFAM:	PF07643	Sequences: CSIDPTPEGLARLQQFLRQLGGRLTPGQRQAWLAGLREALGPQDITVTGVPPDSHFARVLVEADYRMKLIGMGLEPPPVGLPSY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	84 (84)
Sequences:	3029 (2246)
Seq/√Len:	245.1
META:	0.987

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
16_F	35_G	3.819	1.00
4_D	46_T	3.511	1.00
47_V	61_V	2.896	1.00
6_T	9_G	2.792	1.00
35_G	39_A	2.504	1.00
34_A	38_E	2.236	1.00
14_Q	18_R	2.225	1.00
6_T	44_D	2.180	1.00
45_I	61_V	1.983	1.00
34_A	37_R	1.911	1.00
50_V	56_F	1.836	1.00
8_E	12_R	1.763	1.00
15_Q	19_Q	1.755	1.00
16_F	39_A	1.707	1.00
20_L	32_W	1.651	1.00
62_E	66_R	1.604	1.00
29_R	33_L	1.593	1.00
24_L	27_G	1.543	1.00
11_A	15_Q	1.526	1.00
69_L	75_E	1.474	1.00
13_L	17_L	1.471	1.00
17_L	36_L	1.469	1.00
66_R	75_E	1.453	1.00
70_I	77_P	1.416	1.00
1_C	61_V	1.410	1.00
17_L	20_L	1.336	1.00
78_P	81_L	1.268	1.00
28_Q	31_A	1.243	1.00
25_T	28_Q	1.228	1.00
16_F	20_L	1.225	1.00
77_P	80_G	1.222	1.00
13_L	40_L	1.214	1.00
55_H	59_V	1.213	1.00
31_A	35_G	1.205	1.00
12_R	15_Q	1.139	1.00
12_R	39_A	1.137	1.00
7_P	10_L	1.100	1.00
9_G	12_R	1.098	1.00
7_P	11_A	1.090	1.00
10_L	14_Q	1.084	1.00
55_H	58_R	1.081	1.00
25_T	29_R	1.050	1.00
35_G	38_E	1.010	1.00
19_Q	22_G	1.003	1.00
14_Q	17_L	0.980	1.00
62_E	72_M	0.974	1.00
15_Q	18_R	0.942	1.00
17_L	22_G	0.914	1.00
2_S	46_T	0.909	1.00
3_I	43_Q	0.906	1.00
13_L	36_L	0.863	0.99
36_L	39_A	0.856	0.99
47_V	52_P	0.851	0.99
50_V	60_L	0.804	0.99
70_I	81_L	0.801	0.99
26_P	29_R	0.774	0.99
30_Q	34_A	0.773	0.99
78_P	82_P	0.771	0.99
21_G	32_W	0.761	0.99
9_G	41_G	0.750	0.98
26_P	32_W	0.746	0.98
72_M	83_S	0.742	0.98
10_L	55_H	0.737	0.98
77_P	81_L	0.727	0.98
64_D	68_K	0.726	0.98
30_Q	33_L	0.725	0.98
72_M	77_P	0.725	0.98
9_G	39_A	0.716	0.98
47_V	60_L	0.715	0.98
17_L	33_L	0.715	0.98
50_V	54_S	0.714	0.98
20_L	35_G	0.709	0.98
77_P	82_P	0.706	0.98
17_L	21_G	0.698	0.97
22_G	34_A	0.694	0.97
51_P	54_S	0.685	0.97
31_A	34_A	0.684	0.97
11_A	18_R	0.682	0.97
56_F	60_L	0.673	0.97
79_V	82_P	0.665	0.97
10_L	63_A	0.660	0.96
59_V	65_Y	0.654	0.96
57_A	65_Y	0.654	0.96
36_L	40_L	0.649	0.96
19_Q	35_G	0.648	0.96
19_Q	39_A	0.645	0.96
37_R	74_L	0.639	0.96
13_L	39_A	0.636	0.96
9_G	40_L	0.635	0.96
6_T	12_R	0.635	0.96
21_G	29_R	0.627	0.95
54_S	60_L	0.625	0.95
49_G	61_V	0.616	0.95
33_L	37_R	0.605	0.94
67_M	71_G	0.601	0.94
15_Q	39_A	0.589	0.93
24_L	32_W	0.586	0.93
29_R	32_W	0.584	0.93
26_P	33_L	0.578	0.93
6_T	39_A	0.577	0.93
27_G	30_Q	0.577	0.93
9_G	13_L	0.575	0.93
37_R	54_S	0.573	0.93
76_P	80_G	0.572	0.92
32_W	36_L	0.570	0.92
3_I	67_M	0.567	0.92
72_M	80_G	0.562	0.92
10_L	40_L	0.562	0.92
71_G	84_Y	0.549	0.91
3_I	72_M	0.543	0.90
24_L	29_R	0.543	0.90
27_G	31_A	0.541	0.90
7_P	44_D	0.540	0.90
1_C	47_V	0.538	0.90
21_G	43_Q	0.536	0.90
42_P	51_P	0.534	0.90
63_A	73_G	0.532	0.90
70_I	78_P	0.531	0.89
9_G	71_G	0.529	0.89
40_L	43_Q	0.528	0.89
19_Q	31_A	0.527	0.89
33_L	38_E	0.518	0.88
65_Y	75_E	0.514	0.88
79_V	83_S	0.508	0.87
46_T	61_V	0.501	0.87
65_Y	69_L	0.500	0.86

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4gfjA	1	0.75	47.4	0.882	Contact Map
2csbA	1	0.75	37.1	0.889	Contact Map
3m6zA	1	0.75	36.4	0.89	Contact Map
4bjtA	1	0.9405	22.6	0.9	Contact Map
2r5rA	4	0.8333	16.9	0.906	Contact Map
3d2oA	4	0.8333	16.4	0.907	Contact Map
1hjrA	2	0.4524	13.2	0.91	Contact Map
2lcqA	1	0.8095	12.7	0.911	Contact Map
1pq4A	1	0.8333	12.6	0.911	Contact Map
4ep4A	2	0.4762	12.2	0.912	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.