DUF1580 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1580 - Protein of unknown function (DUF1580)

PFAM:	PF07618	Sequences: PLAEAAKLRPGRRPHVSTLWRWALRGVRDGVRLETVRVGGRRYTSREALQRFIEATT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	57 (46)
Sequences:	2737 (2255)
Seq/√Len:	332.5
META:	0.988

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
23_A	35_T	3.461	1.00
35_T	42_R	3.082	1.00
34_E	51_R	2.739	1.00
34_E	48_A	2.147	1.00
50_Q	54_E	2.110	1.00
37_R	42_R	1.983	1.00
16_V	20_W	1.675	1.00
46_R	50_Q	1.632	1.00
20_W	24_L	1.626	1.00
15_H	18_T	1.587	1.00
47_E	51_R	1.576	1.00
49_L	53_I	1.276	1.00
45_S	48_A	1.268	1.00
48_A	51_R	1.222	1.00
20_W	23_A	1.195	1.00
44_T	48_A	1.148	1.00
38_V	53_I	1.136	1.00
45_S	51_R	1.113	1.00
26_G	52_F	1.061	1.00
17_S	20_W	1.025	1.00
36_V	45_S	1.025	1.00
32_R	35_T	1.024	1.00
23_A	42_R	1.021	1.00
34_E	52_F	1.003	1.00
15_H	20_W	0.997	1.00
38_V	43_Y	0.988	1.00
9_R	49_L	0.941	1.00
36_V	43_Y	0.885	1.00
14_P	22_W	0.883	1.00
36_V	53_I	0.881	1.00
22_W	49_L	0.846	1.00
26_G	30_G	0.836	1.00
18_T	22_W	0.833	1.00
36_V	48_A	0.829	1.00
27_V	30_G	0.806	1.00
12_R	41_R	0.792	1.00
14_P	19_L	0.784	1.00
9_R	12_R	0.776	1.00
43_Y	53_I	0.752	0.99
24_L	42_R	0.742	0.99
31_V	55_A	0.731	0.99
28_R	37_R	0.730	0.99
17_S	21_R	0.721	0.99
31_V	53_I	0.706	0.99
27_V	52_F	0.670	0.99
47_E	50_Q	0.652	0.99
20_W	42_R	0.651	0.99
44_T	49_L	0.647	0.98
27_V	31_V	0.639	0.98
34_E	45_S	0.638	0.98
19_L	23_A	0.608	0.98
26_G	32_R	0.608	0.98
37_R	40_G	0.603	0.98
18_T	39_G	0.594	0.97
9_R	14_P	0.592	0.97
22_W	27_V	0.574	0.97
27_V	40_G	0.561	0.96
34_E	44_T	0.557	0.96
13_R	21_R	0.557	0.96
31_V	52_F	0.557	0.96
50_Q	53_I	0.549	0.96
10_P	43_Y	0.536	0.95
10_P	14_P	0.528	0.95
25_R	33_L	0.527	0.95
11_G	14_P	0.526	0.95
24_L	37_R	0.522	0.95
28_R	40_G	0.509	0.94
23_A	37_R	0.502	0.93
36_V	44_T	0.500	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1y6uA	1	0.8772	94.7	0.691	Contact Map
4j2nA	4	0.8421	92.6	0.715	Contact Map
1z4hA	1	0.8596	91.4	0.725	Contact Map
1j9iA	2	0.8421	90.4	0.731	Contact Map
2og0A	1	0.8421	87.6	0.745	Contact Map
1pm6A	1	0.8947	79.4	0.769	Contact Map
2kfsA	1	0.8596	74.8	0.778	Contact Map
2ao9A	7	0.8947	55.3	0.805	Contact Map
2elhA	1	0.8421	46.8	0.815	Contact Map
2jmlA	1	0.8772	46.5	0.815	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0039 seconds.