UnbV_ASPIC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

UnbV_ASPIC - ASPIC and UnbV

PFAM:	PF07593	Sequences: AIGARVTVTAGGGTQVREVRSGSGYLSQSDLRLHFGLGKATKVDSVEVRWPSGKVQTLTNVAADQILT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	68 (67)
Sequences:	84743 (50746)
Seq/√Len:	6199.6
META:	0.977

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
45_S	57_T	2.755	1.00
9_T	45_S	2.636	1.00
7_T	49_R	2.337	1.00
9_T	14_T	2.167	1.00
47_E	55_V	2.133	1.00
7_T	14_T	2.120	1.00
7_T	47_E	2.101	1.00
49_R	55_V	1.980	1.00
47_E	57_T	1.883	1.00
42_K	60_N	1.690	1.00
9_T	47_E	1.664	1.00
6_V	33_L	1.662	1.00
17_R	35_F	1.659	1.00
7_T	16_V	1.658	1.00
5_R	18_E	1.600	1.00
45_S	59_T	1.596	1.00
10_A	15_Q	1.491	1.00
5_R	16_V	1.430	1.00
17_R	33_L	1.396	1.00
19_V	33_L	1.396	1.00
50_W	56_Q	1.326	1.00
8_V	35_F	1.295	1.00
32_R	66_I	1.279	1.00
11_G	40_A	1.262	1.00
13_G	40_A	1.260	1.00
11_G	44_D	1.248	1.00
23_S	29_S	1.199	1.00
62_A	65_Q	1.184	1.00
61_V	67_L	1.168	1.00
9_T	44_D	1.118	1.00
5_R	49_R	1.109	1.00
12_G	40_A	1.105	1.00
46_V	61_V	1.096	1.00
10_A	40_A	1.093	1.00
37_L	63_A	1.052	1.00
58_L	61_V	1.052	1.00
4_A	48_V	1.037	1.00
20_R	23_S	1.005	1.00
28_Q	31_L	0.994	1.00
30_D	34_H	0.967	1.00
37_L	43_V	0.948	1.00
42_K	62_A	0.943	1.00
10_A	13_G	0.933	1.00
22_G	28_Q	0.924	1.00
23_S	26_L	0.896	1.00
43_V	63_A	0.872	1.00
8_V	37_L	0.864	1.00
21_S	28_Q	0.841	1.00
34_H	66_I	0.837	1.00
19_V	31_L	0.820	1.00
23_S	30_D	0.818	1.00
40_A	44_D	0.810	1.00
2_I	21_S	0.809	1.00
8_V	43_V	0.764	1.00
8_V	46_V	0.744	1.00
15_Q	35_F	0.744	1.00
2_I	31_L	0.737	1.00
23_S	27_S	0.730	1.00
19_V	30_D	0.726	1.00
20_R	26_L	0.711	1.00
22_G	29_S	0.710	1.00
21_S	31_L	0.701	1.00
17_R	20_R	0.695	1.00
19_V	32_R	0.693	1.00
4_A	51_P	0.688	1.00
21_S	29_S	0.667	1.00
41_T	62_A	0.646	1.00
25_Y	28_Q	0.638	1.00
1_A	4_A	0.630	1.00
6_V	46_V	0.627	1.00
2_I	22_G	0.621	1.00
2_I	19_V	0.620	1.00
17_R	22_G	0.606	1.00
48_V	58_L	0.603	1.00
20_R	29_S	0.603	1.00
23_S	28_Q	0.600	1.00
19_V	22_G	0.589	1.00
11_G	42_K	0.581	1.00
63_A	67_L	0.573	1.00
2_I	20_R	0.573	1.00
1_A	19_V	0.569	1.00
31_L	34_H	0.568	1.00
19_V	24_G	0.567	1.00
46_V	67_L	0.558	1.00
24_G	30_D	0.557	1.00
24_G	29_S	0.547	1.00
1_A	56_Q	0.544	1.00
6_V	48_V	0.541	1.00
10_A	44_D	0.540	1.00
26_L	30_D	0.538	1.00
4_A	19_V	0.533	1.00
44_D	59_T	0.521	1.00
62_A	67_L	0.518	1.00
17_R	34_H	0.517	1.00
61_V	65_Q	0.514	1.00
18_E	23_S	0.513	1.00
24_G	36_G	0.509	1.00
58_L	67_L	0.506	1.00
6_V	35_F	0.503	1.00
52_S	55_V	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2qqrA	1	0.9706	36.6	0.817	Contact Map
4a7kA	2	0.9559	22.4	0.835	Contact Map
2xdpA	2	0.9706	19.3	0.84	Contact Map
3ujzA	2	0.4118	16.1	0.846	Contact Map
2mamA	1	0.9412	12.6	0.853	Contact Map
3dmqA	1	0.7206	11.1	0.856	Contact Map
2mcaA	1	0.6765	9.6	0.861	Contact Map
1nc7A	3	0.9265	8.7	0.863	Contact Map
2e5pA	1	0.5588	8.2	0.864	Contact Map
2iiaA	3	0.7941	6.4	0.871	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.