BCNT - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

BCNT - Bucentaur or craniofacial development

PFAM:	PF07572	Sequences: KSGLDSLLAQLGAKKKKLSTLEKSKLDWASFKDKEGIKDELEAHNKGKDGYLEKQDFLQRVDARRFEEERDARLK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	75 (71)
Sequences:	577 (409)
Seq/√Len:	48.5
META:	0.423

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
55_Q	59_Q	3.213	1.00
61_V	65_R	2.758	1.00
52_L	56_D	2.647	1.00
66_F	69_E	2.471	1.00
23_K	27_D	2.060	1.00
31_F	37_I	1.993	0.99
66_F	70_R	1.966	0.99
70_R	73_R	1.920	0.99
70_R	74_L	1.871	0.99
21_L	45_N	1.820	0.99
42_E	45_N	1.766	0.99
29_A	32_K	1.737	0.99
3_G	6_S	1.676	0.98
24_S	50_G	1.491	0.96
44_H	54_K	1.480	0.96
9_A	13_A	1.458	0.96
29_A	33_D	1.448	0.95
58_L	62_D	1.432	0.95
71_D	74_L	1.325	0.93
39_D	42_E	1.303	0.92
33_D	38_K	1.291	0.92
69_E	73_R	1.290	0.92
32_K	66_F	1.288	0.92
21_L	69_E	1.258	0.91
24_S	72_A	1.217	0.89
18_L	26_L	1.189	0.88
40_E	47_G	1.133	0.85
62_D	69_E	1.126	0.85
32_K	65_R	1.113	0.84
59_Q	62_D	1.085	0.83
37_I	41_L	1.082	0.83
3_G	11_L	1.070	0.82
49_D	54_K	1.067	0.82
50_G	53_E	1.053	0.81
43_A	46_K	1.043	0.80
63_A	67_E	1.028	0.79
19_S	52_L	1.026	0.79
47_G	53_E	1.002	0.77
54_K	74_L	0.995	0.77
18_L	23_K	0.962	0.74
60_R	64_R	0.960	0.74
65_R	68_E	0.959	0.74
24_S	35_E	0.956	0.74
14_K	21_L	0.937	0.72
8_L	32_K	0.935	0.72
33_D	36_G	0.933	0.72
67_E	71_D	0.923	0.71
20_T	65_R	0.899	0.69
22_E	38_K	0.894	0.69
68_E	71_D	0.877	0.67
62_D	66_F	0.870	0.67
7_L	63_A	0.852	0.65
4_L	7_L	0.846	0.65
15_K	21_L	0.845	0.64
19_S	68_E	0.835	0.64
25_K	31_F	0.819	0.62
32_K	41_L	0.816	0.62
22_E	25_K	0.811	0.61
59_Q	63_A	0.773	0.58
45_N	50_G	0.753	0.56
20_T	29_A	0.752	0.55
5_D	35_E	0.744	0.55
21_L	26_L	0.733	0.54
61_V	64_R	0.723	0.53
8_L	11_L	0.712	0.51
49_D	63_A	0.709	0.51
19_S	62_D	0.707	0.51
25_K	61_V	0.707	0.51
37_I	45_N	0.678	0.48
64_R	68_E	0.674	0.48
3_G	7_L	0.674	0.48
20_T	60_R	0.671	0.47
21_L	24_S	0.670	0.47
38_K	43_A	0.661	0.46
32_K	37_I	0.656	0.46
38_K	42_E	0.652	0.45
19_S	29_A	0.652	0.45
42_E	46_K	0.651	0.45
10_Q	56_D	0.645	0.45
31_F	34_K	0.626	0.43
19_S	67_E	0.623	0.43
23_K	26_L	0.621	0.42
39_D	60_R	0.617	0.42
62_D	65_R	0.611	0.41
32_K	45_N	0.606	0.41
43_A	48_K	0.598	0.40
10_Q	49_D	0.591	0.39
17_K	41_L	0.586	0.39
20_T	53_E	0.580	0.38
55_Q	61_V	0.567	0.37
19_S	60_R	0.567	0.37
9_A	48_K	0.565	0.37
24_S	52_L	0.564	0.37
26_L	31_F	0.563	0.37
38_K	67_E	0.561	0.37
64_R	67_E	0.561	0.37
66_F	74_L	0.560	0.36
32_K	44_H	0.560	0.36
17_K	22_E	0.554	0.36
30_S	38_K	0.539	0.34
24_S	27_D	0.521	0.33
6_S	40_E	0.517	0.33
36_G	73_R	0.516	0.32
3_G	35_E	0.506	0.32
31_F	64_R	0.502	0.31
61_V	66_F	0.500	0.31

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ejfA	1	0.4133	4.4	0.907	Contact Map
3s4rA	2	0.5733	2.8	0.916	Contact Map
3aa0A	1	0.44	2.7	0.917	Contact Map
3q3wA	1	0.12	2.6	0.917	Contact Map
3h4sE	1	0.6	2.5	0.918	Contact Map
4mspA	2	0.76	2.3	0.92	Contact Map
1r9dA	2	0.6533	2.3	0.92	Contact Map
4twcA	1	0.44	2	0.921	Contact Map
1y1xA	2	0.8533	1.9	0.923	Contact Map
4mzjA	1	0.9867	1.9	0.923	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.