NOC3p - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

NOC3p - Nucleolar complex-associated protein

PFAM:	PF07540	Sequences: QAKEEIAELASAILEDPEENIGLLKRLLELAESKDDPTVRKLALLSLLAVFKDIIPGYRIRPLTEKEKAEKVSKEVKKLRDYEQALLSGYQAY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	93 (92)
Sequences:	672 (475)
Seq/√Len:	49.6
META:	0.363

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
73_S	76_V	4.310	1.00
6_I	46_S	3.828	1.00
24_L	54_I	3.503	1.00
63_L	72_V	3.335	1.00
28_L	47_L	3.293	1.00
64_T	67_E	2.806	1.00
10_A	46_S	2.782	1.00
47_L	51_F	2.524	1.00
48_L	93_Y	2.140	1.00
38_T	41_K	2.039	1.00
31_A	43_A	1.857	0.99
64_T	72_V	1.657	0.98
68_K	72_V	1.563	0.97
47_L	93_Y	1.563	0.97
22_G	26_R	1.540	0.97
41_K	93_Y	1.539	0.97
12_A	20_N	1.518	0.97
23_L	77_K	1.437	0.95
61_R	67_E	1.413	0.95
84_Q	87_L	1.347	0.94
49_A	53_D	1.310	0.93
15_E	19_E	1.274	0.92
67_E	72_V	1.264	0.91
13_I	21_I	1.221	0.90
27_L	58_Y	1.209	0.89
28_L	89_G	1.204	0.89
10_A	42_L	1.152	0.87
21_I	24_L	1.150	0.87
10_A	50_V	1.136	0.86
71_K	75_E	1.117	0.85
33_S	87_L	1.115	0.85
6_I	43_A	1.106	0.85
63_L	68_K	1.089	0.84
84_Q	89_G	1.086	0.83
16_D	78_K	1.062	0.82
5_E	70_E	1.061	0.82
76_V	80_R	1.059	0.82
14_L	28_L	1.047	0.81
63_L	87_L	1.042	0.81
16_D	19_E	1.019	0.79
27_L	47_L	1.015	0.79
65_E	68_K	1.000	0.78
6_I	27_L	0.999	0.78
85_A	89_G	0.989	0.77
3_K	14_L	0.982	0.77
73_S	80_R	0.980	0.77
52_K	93_Y	0.975	0.76
65_E	69_A	0.966	0.76
18_E	52_K	0.965	0.75
75_E	79_L	0.950	0.74
11_S	43_A	0.948	0.74
14_L	54_I	0.941	0.74
72_V	76_V	0.930	0.73
9_L	27_L	0.908	0.71
18_E	78_K	0.899	0.70
11_S	30_L	0.894	0.70
41_K	55_I	0.862	0.67
10_A	28_L	0.857	0.66
66_K	70_E	0.856	0.66
24_L	34_K	0.853	0.66
43_A	50_V	0.834	0.64
61_R	68_K	0.831	0.64
61_R	64_T	0.825	0.63
75_E	78_K	0.817	0.63
35_D	39_V	0.814	0.62
30_L	48_L	0.809	0.62
2_A	39_V	0.805	0.62
63_L	70_E	0.800	0.61
66_K	69_A	0.787	0.60
29_E	34_K	0.785	0.60
61_R	80_R	0.784	0.59
7_A	20_N	0.779	0.59
28_L	92_A	0.769	0.58
63_L	80_R	0.765	0.58
50_V	93_Y	0.762	0.57
12_A	81_D	0.739	0.55
82_Y	86_L	0.737	0.55
6_I	30_L	0.736	0.55
5_E	26_R	0.736	0.55
48_L	52_K	0.734	0.54
6_I	10_A	0.732	0.54
33_S	39_V	0.729	0.54
31_A	87_L	0.723	0.53
65_E	80_R	0.717	0.53
31_A	44_L	0.707	0.52
76_V	83_E	0.704	0.51
64_T	68_K	0.702	0.51
70_E	84_Q	0.696	0.51
31_A	47_L	0.677	0.49
32_E	39_V	0.677	0.49
3_K	45_L	0.676	0.49
14_L	55_I	0.671	0.48
67_E	75_E	0.660	0.47
21_I	89_G	0.651	0.46
13_I	23_L	0.650	0.46
7_A	15_E	0.645	0.45
60_I	71_K	0.638	0.45
7_A	44_L	0.635	0.44
50_V	88_S	0.632	0.44
25_K	87_L	0.631	0.44
40_R	50_V	0.627	0.44
35_D	48_L	0.620	0.43
23_L	44_L	0.612	0.42
39_V	71_K	0.608	0.42
46_S	49_A	0.605	0.41
72_V	78_K	0.603	0.41
2_A	14_L	0.599	0.41
31_A	35_D	0.598	0.41
15_E	52_K	0.597	0.41
45_L	48_L	0.595	0.40
7_A	49_A	0.593	0.40
45_L	76_V	0.585	0.39
41_K	45_L	0.580	0.39
48_L	70_E	0.577	0.39
28_L	91_Q	0.576	0.39
62_P	84_Q	0.573	0.38
32_E	69_A	0.573	0.38
63_L	84_Q	0.566	0.38
27_L	31_A	0.561	0.37
8_E	12_A	0.560	0.37
13_I	69_A	0.558	0.37
8_E	20_N	0.552	0.36
28_L	77_K	0.549	0.36
37_P	89_G	0.544	0.36
58_Y	79_L	0.537	0.35
22_G	43_A	0.536	0.35
89_G	92_A	0.533	0.35
54_I	86_L	0.531	0.34
67_E	70_E	0.530	0.34
27_L	46_S	0.530	0.34
3_K	74_K	0.523	0.34
10_A	17_P	0.522	0.34
10_A	27_L	0.519	0.33
8_E	77_K	0.518	0.33
11_S	14_L	0.509	0.32
89_G	93_Y	0.508	0.32
64_T	78_K	0.505	0.32
8_E	40_R	0.500	0.32

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ovjA	1	0.957	20.1	0.894	Contact Map
4ev8A	1	0.5269	6	0.916	Contact Map
3u0rA	1	0.9355	5.9	0.917	Contact Map
4db6A	1	0.5484	5.6	0.918	Contact Map
5aj3J	1	0.3548	4.8	0.92	Contact Map
3o2tA	1	0.8925	4.3	0.922	Contact Map
4hxtA	2	0.6129	3.9	0.924	Contact Map
3cxlA	1	0.9355	3.4	0.926	Contact Map
2yinA	1	0.9355	3.2	0.927	Contact Map
4rv1A	1	0.6129	3.2	0.927	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.