PRE_C2HC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PRE_C2HC - Associated with zinc fingers

PFAM:	PF07530	Sequences: TEDIKQELEELGHKVRNVTNIKHRVTKEPLPLFFVDLEPAENNKDIYKITALLNTKIKVEPPRKKKNI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	68 (65)
Sequences:	912 (585)
Seq/√Len:	72.5
META:	0.83

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
7_E	10_E	3.518	1.00
20_N	33_F	3.279	1.00
16_R	38_E	2.846	1.00
51_A	56_K	2.667	1.00
5_K	9_E	2.469	1.00
45_D	48_K	2.224	1.00
42_N	45_D	1.967	1.00
36_D	39_P	1.830	1.00
7_E	11_L	1.690	1.00
21_I	34_F	1.638	1.00
49_I	57_I	1.504	0.99
36_D	62_P	1.485	0.99
49_I	59_V	1.484	0.99
47_Y	61_P	1.453	0.99
2_E	6_Q	1.451	0.99
21_I	31_P	1.300	0.97
13_H	43_N	1.292	0.97
37_L	43_N	1.279	0.97
14_K	35_V	1.237	0.97
6_Q	9_E	1.224	0.96
19_T	53_L	1.214	0.96
19_T	22_K	1.195	0.96
39_P	62_P	1.150	0.95
2_E	5_K	1.149	0.95
6_Q	10_E	1.136	0.94
50_T	56_K	1.093	0.93
30_L	55_T	1.093	0.93
9_E	15_V	1.054	0.92
4_I	8_L	1.054	0.92
16_R	39_P	1.049	0.92
55_T	64_K	1.045	0.91
14_K	38_E	1.012	0.90
50_T	58_K	1.009	0.90
35_V	59_V	1.003	0.90
20_N	36_D	1.001	0.90
31_P	65_K	0.989	0.89
18_V	23_H	0.982	0.89
3_D	47_Y	0.963	0.88
51_A	55_T	0.945	0.87
25_V	50_T	0.945	0.87
47_Y	53_L	0.943	0.87
13_H	42_N	0.933	0.86
17_N	36_D	0.904	0.84
59_V	64_K	0.896	0.84
22_K	37_L	0.885	0.83
34_F	39_P	0.884	0.83
23_H	26_T	0.869	0.82
44_K	48_K	0.848	0.80
3_D	6_Q	0.827	0.79
31_P	55_T	0.811	0.77
22_K	27_K	0.799	0.76
7_E	53_L	0.776	0.74
19_T	28_E	0.774	0.74
34_F	55_T	0.769	0.73
2_E	25_V	0.769	0.73
11_L	52_L	0.750	0.71
6_Q	32_L	0.734	0.70
13_H	49_I	0.733	0.70
28_E	51_A	0.731	0.70
13_H	40_A	0.729	0.69
23_H	30_L	0.728	0.69
17_N	34_F	0.724	0.69
13_H	45_D	0.722	0.69
31_P	54_N	0.711	0.67
7_E	52_L	0.694	0.66
41_E	49_I	0.686	0.65
25_V	52_L	0.683	0.64
31_P	56_K	0.681	0.64
8_L	15_V	0.680	0.64
56_K	64_K	0.678	0.64
28_E	32_L	0.669	0.63
11_L	26_T	0.648	0.60
9_E	50_T	0.621	0.57
28_E	31_P	0.609	0.56
12_G	17_N	0.608	0.55
61_P	64_K	0.596	0.54
23_H	55_T	0.591	0.53
31_P	66_K	0.589	0.53
50_T	57_I	0.586	0.53
27_K	62_P	0.585	0.53
17_N	20_N	0.582	0.52
23_H	28_E	0.572	0.51
2_E	41_E	0.566	0.50
58_K	64_K	0.561	0.50
32_L	58_K	0.551	0.48
48_K	65_K	0.549	0.48
26_T	29_P	0.541	0.47
21_I	32_L	0.540	0.47
34_F	43_N	0.539	0.47
5_K	56_K	0.533	0.46
23_H	29_P	0.530	0.46
34_F	52_L	0.525	0.45
11_L	22_K	0.513	0.44
22_K	28_E	0.507	0.43
7_E	46_I	0.507	0.43
34_F	62_P	0.505	0.43
12_G	43_N	0.505	0.43
9_E	48_K	0.500	0.42

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3q2sC	1	1	62.7	0.806	Contact Map
1x4bA	1	0.9853	57	0.813	Contact Map
3n9uC	1	1	55.2	0.815	Contact Map
2dh8A	1	0.9853	53.9	0.817	Contact Map
1p27B	1	0.9853	53.7	0.817	Contact Map
2cqgA	1	0.9853	52.9	0.818	Contact Map
2cqdA	1	0.9853	52.8	0.818	Contact Map
1x5uA	1	0.9853	52.2	0.819	Contact Map
2lxiA	1	1	51.6	0.819	Contact Map
3pgwS	1	0.9559	51.6	0.819	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.