POX - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

POX - Associated with HOX

PFAM:	PF07526	Sequences: VLRNSKYLKPAQELLDEFCSVGKKGKKSSSASKKSKKKSSGSSESSGGDGSSSSSSSSKSSPELSTAERQELQRKKAKLLSMLDEVDRRYKQYYHQMQAVVSSFEAVAGLGAAKPYTALALKTISRHFRCLRDAIS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	136 (135)
Sequences:	763 (595)
Seq/√Len:	51.2
META:	0.018

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
119_L	134_A	2.986	1.00
27_K	30_S	2.555	1.00
37_K	41_G	2.465	1.00
106_A	132_R	2.463	1.00
103_S	107_V	2.334	1.00
91_K	108_A	2.332	1.00
53_S	57_S	2.211	1.00
21_V	84_D	2.181	1.00
36_K	39_S	2.121	1.00
78_K	85_E	2.103	1.00
22_G	132_R	2.073	1.00
126_R	132_R	2.016	1.00
75_K	124_I	2.000	1.00
118_A	122_K	1.874	0.99
26_K	29_S	1.863	0.99
82_M	97_M	1.787	0.99
95_H	99_A	1.714	0.99
45_S	48_G	1.706	0.99
41_G	46_S	1.705	0.99
41_G	44_E	1.630	0.98
25_G	28_S	1.629	0.98
116_Y	128_F	1.612	0.98
28_S	33_K	1.546	0.97
29_S	32_S	1.541	0.97
36_K	40_S	1.539	0.97
84_D	115_P	1.530	0.97
16_D	22_G	1.511	0.97
82_M	85_E	1.496	0.97
27_K	31_A	1.468	0.96
51_S	54_S	1.460	0.96
43_S	46_S	1.447	0.96
27_K	34_K	1.400	0.95
38_K	42_S	1.387	0.95
93_Y	128_F	1.371	0.95
34_K	41_G	1.367	0.95
98_Q	105_E	1.356	0.94
96_Q	113_A	1.348	0.94
87_D	132_R	1.338	0.94
7_Y	40_S	1.336	0.94
43_S	47_G	1.318	0.93
3_R	92_Q	1.294	0.93
108_A	120_A	1.290	0.93
3_R	76_K	1.276	0.92
35_S	38_K	1.265	0.92
39_S	42_S	1.258	0.92
30_S	33_K	1.253	0.92
77_A	100_V	1.237	0.91
11_A	17_E	1.217	0.90
83_L	111_G	1.201	0.90
8_L	121_L	1.191	0.89
3_R	107_V	1.186	0.89
82_M	130_C	1.175	0.89
109_G	116_Y	1.165	0.88
57_S	60_S	1.145	0.87
76_K	107_V	1.136	0.87
4_N	118_A	1.127	0.87
46_S	53_S	1.108	0.86
27_K	35_S	1.104	0.85
41_G	45_S	1.100	0.85
31_A	37_K	1.097	0.85
2_L	88_R	1.097	0.85
54_S	57_S	1.082	0.84
81_S	103_S	1.074	0.84
69_R	117_T	1.069	0.84
33_K	40_S	1.056	0.83
8_L	108_A	1.052	0.83
40_S	44_E	1.049	0.82
105_E	126_R	1.046	0.82
3_R	12_Q	1.045	0.82
88_R	127_H	1.038	0.82
25_G	29_S	1.036	0.82
20_S	95_H	1.025	0.81
22_G	124_I	1.023	0.81
89_R	105_E	1.013	0.80
33_K	36_K	1.009	0.80
106_A	112_A	1.002	0.79
34_K	38_K	1.000	0.79
38_K	41_G	0.992	0.79
44_E	47_G	0.991	0.79
81_S	98_Q	0.991	0.79
16_D	98_Q	0.986	0.78
72_L	133_D	0.970	0.77
53_S	56_S	0.961	0.76
7_Y	95_H	0.947	0.75
43_S	48_G	0.946	0.75
52_S	58_S	0.944	0.75
66_T	69_R	0.935	0.74
68_E	115_P	0.933	0.74
112_A	116_Y	0.925	0.74
106_A	114_K	0.925	0.74
80_L	105_E	0.917	0.73
72_L	117_T	0.914	0.73
66_T	112_A	0.909	0.72
76_K	106_A	0.894	0.71
77_A	106_A	0.886	0.70
91_K	110_L	0.881	0.70
54_S	58_S	0.877	0.70
32_S	47_G	0.876	0.69
35_S	42_S	0.875	0.69
24_K	28_S	0.873	0.69
51_S	55_S	0.871	0.69
30_S	34_K	0.867	0.69
40_S	43_S	0.866	0.69
3_R	106_A	0.857	0.68
26_K	30_S	0.856	0.68
43_S	51_S	0.855	0.68
109_G	113_A	0.854	0.67
37_K	44_E	0.850	0.67
52_S	56_S	0.850	0.67
26_K	44_E	0.847	0.67
22_G	123_T	0.845	0.67
88_R	130_C	0.838	0.66
109_G	128_F	0.829	0.65
39_S	45_S	0.821	0.64
37_K	43_S	0.819	0.64
85_E	128_F	0.817	0.64
98_Q	115_P	0.815	0.64
7_Y	111_G	0.813	0.64
34_K	39_S	0.812	0.64
18_F	92_Q	0.800	0.62
93_Y	116_Y	0.800	0.62
77_A	81_S	0.796	0.62
83_L	123_T	0.796	0.62
125_S	129_R	0.788	0.61
80_L	85_E	0.780	0.60
6_K	99_A	0.780	0.60
27_K	33_K	0.772	0.60
45_S	49_D	0.767	0.59
4_N	119_L	0.767	0.59
29_S	35_S	0.767	0.59
22_G	80_L	0.767	0.59
18_F	95_H	0.762	0.59
74_R	124_I	0.758	0.58
9_K	134_A	0.744	0.57
25_G	32_S	0.734	0.56
87_D	133_D	0.728	0.55
42_S	53_S	0.712	0.54
83_L	119_L	0.711	0.53
10_P	127_H	0.706	0.53
31_A	36_K	0.703	0.53
37_K	42_S	0.701	0.52
124_I	127_H	0.699	0.52
37_K	56_S	0.690	0.51
76_K	81_S	0.679	0.50
47_G	53_S	0.672	0.49
31_A	47_G	0.670	0.49
74_R	88_R	0.669	0.49
28_S	48_G	0.668	0.49
42_S	50_G	0.664	0.49
31_A	46_S	0.656	0.48
18_F	75_K	0.645	0.47
2_L	5_S	0.642	0.46
42_S	60_S	0.629	0.45
48_G	51_S	0.627	0.45
12_Q	78_K	0.625	0.45
26_K	40_S	0.624	0.44
33_K	39_S	0.623	0.44
29_S	43_S	0.616	0.44
76_K	129_R	0.615	0.43
4_N	73_Q	0.611	0.43
46_S	49_D	0.611	0.43
88_R	94_Y	0.610	0.43
37_K	45_S	0.610	0.43
35_S	46_S	0.609	0.43
26_K	31_A	0.601	0.42
31_A	35_S	0.599	0.42
108_A	113_A	0.593	0.41
48_G	61_S	0.589	0.41
19_C	74_R	0.588	0.41
34_K	40_S	0.587	0.41
36_K	42_S	0.583	0.40
70_Q	114_K	0.574	0.39
13_E	97_M	0.573	0.39
46_S	51_S	0.559	0.38
52_S	55_S	0.558	0.38
101_V	122_K	0.555	0.37
74_R	87_D	0.554	0.37
37_K	60_S	0.553	0.37
93_Y	127_H	0.551	0.37
56_S	59_K	0.550	0.37
63_E	66_T	0.547	0.37
128_F	134_A	0.542	0.36
27_K	32_S	0.541	0.36
48_G	53_S	0.540	0.36
4_N	105_E	0.528	0.35
43_S	49_D	0.527	0.35
55_S	58_S	0.527	0.35
10_P	105_E	0.524	0.35
10_P	85_E	0.524	0.35
93_Y	134_A	0.521	0.34
85_E	93_Y	0.521	0.34
105_E	115_P	0.518	0.34
100_V	131_L	0.516	0.34
126_R	133_D	0.515	0.34
83_L	87_D	0.512	0.33
29_S	34_K	0.509	0.33
105_E	128_F	0.508	0.33
12_Q	85_E	0.507	0.33
36_K	48_G	0.507	0.33
2_L	22_G	0.506	0.33
107_V	115_P	0.501	0.32
20_S	119_L	0.500	0.32

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ymyA	2	0.3015	10	0.945	Contact Map
1x8yA	2	0.4044	9.6	0.945	Contact Map
1we3A	5	0.9926	6.5	0.949	Contact Map
1p5sA	1	0.2941	6.5	0.949	Contact Map
2lyhA	1	0.3088	5.7	0.951	Contact Map
3hugA	3	0.5147	5.7	0.951	Contact Map
4aflA	2	0.5735	5	0.952	Contact Map
2noxA	6	0.6324	4.6	0.953	Contact Map
1iokA	5	0.9118	4.3	0.953	Contact Map
2qwoB	1	0.3824	4.2	0.954	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.