DUF1525 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1525 - Protein of unknown function (DUF1525)

PFAM:	PF07511	Sequences: AEVEVFTDSAHPVTAPAGVRVYELDAPERLEAELSAGLPADPEQAKAIAQQRLQSPGWAALQQRLAQAYQGVADAWQLGIDKYPAVVFDGRYVVYGVTDVARALARYEQWRRR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	113 (110)
Sequences:	831 (593)
Seq/√Len:	56.5
META:	0.65

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
8_D	11_H	4.082	1.00
27_P	69_Y	3.987	1.00
5_V	13_V	3.714	1.00
39_P	48_I	3.507	1.00
46_K	50_Q	3.417	1.00
39_P	45_A	3.193	1.00
97_V	102_R	2.610	1.00
41_D	44_Q	2.273	1.00
88_F	107_Y	2.093	1.00
38_L	45_A	2.018	1.00
86_V	103_A	1.985	1.00
27_P	72_V	1.949	1.00
35_S	38_L	1.854	0.99
23_E	29_R	1.853	0.99
7_T	12_P	1.693	0.99
57_G	61_L	1.600	0.98
92_Y	107_Y	1.574	0.98
6_F	22_Y	1.565	0.98
37_G	52_R	1.563	0.98
22_Y	71_G	1.561	0.98
85_A	95_Y	1.496	0.98
93_V	96_G	1.482	0.97
7_T	11_H	1.437	0.97
108_E	112_R	1.434	0.97
16_P	19_V	1.429	0.97
43_E	46_K	1.420	0.97
92_Y	110_W	1.392	0.96
88_F	92_Y	1.380	0.96
57_G	64_R	1.308	0.95
78_L	87_V	1.296	0.95
106_R	110_W	1.273	0.94
5_V	100_V	1.230	0.93
85_A	93_V	1.226	0.93
78_L	107_Y	1.183	0.91
91_R	101_A	1.182	0.91
49_A	53_L	1.182	0.91
48_I	52_R	1.180	0.91
102_R	105_A	1.153	0.90
73_A	77_Q	1.144	0.90
60_A	63_Q	1.128	0.89
47_A	63_Q	1.099	0.88
6_F	10_A	1.095	0.88
80_I	83_Y	1.091	0.88
54_Q	80_I	1.075	0.87
56_P	72_V	1.067	0.86
4_E	78_L	1.061	0.86
49_A	52_R	1.058	0.86
50_Q	54_Q	1.043	0.85
38_L	41_D	1.034	0.85
77_Q	81_D	1.026	0.84
88_F	97_V	1.022	0.84
4_E	90_G	0.994	0.82
6_F	87_V	0.958	0.80
56_P	82_K	0.950	0.79
2_E	90_G	0.947	0.79
27_P	31_E	0.947	0.79
74_D	78_L	0.942	0.79
82_K	103_A	0.941	0.79
31_E	35_S	0.941	0.79
75_A	85_A	0.940	0.78
64_R	79_G	0.940	0.78
3_V	6_F	0.936	0.78
48_I	51_Q	0.901	0.75
105_A	108_E	0.882	0.74
81_D	97_V	0.875	0.73
101_A	108_E	0.869	0.73
94_V	106_R	0.866	0.73
35_S	52_R	0.851	0.71
9_S	26_A	0.847	0.71
15_A	19_V	0.845	0.71
33_E	48_I	0.831	0.69
105_A	111_R	0.830	0.69
101_A	104_L	0.826	0.69
65_L	98_T	0.823	0.69
35_S	45_A	0.813	0.68
24_L	72_V	0.812	0.68
88_F	110_W	0.810	0.67
83_Y	88_F	0.807	0.67
42_P	54_Q	0.803	0.67
4_E	87_V	0.794	0.66
33_E	64_R	0.786	0.65
20_R	65_L	0.779	0.64
46_K	86_V	0.779	0.64
102_R	109_Q	0.775	0.64
19_V	60_A	0.767	0.63
82_K	100_V	0.759	0.62
22_Y	76_W	0.751	0.62
5_V	16_P	0.746	0.61
73_A	76_W	0.745	0.61
106_R	109_Q	0.741	0.60
45_A	82_K	0.730	0.59
76_W	79_G	0.727	0.59
47_A	67_Q	0.726	0.59
102_R	106_R	0.724	0.59
38_L	42_P	0.721	0.58
30_L	39_P	0.719	0.58
14_T	33_E	0.716	0.58
9_S	37_G	0.710	0.57
43_E	71_G	0.705	0.57
28_E	51_Q	0.702	0.56
47_A	51_Q	0.694	0.55
10_A	14_T	0.690	0.55
77_Q	90_G	0.688	0.55
104_L	108_E	0.683	0.54
25_D	86_V	0.683	0.54
86_V	98_T	0.682	0.54
55_S	61_L	0.682	0.54
32_A	89_D	0.680	0.54
8_D	83_Y	0.677	0.54
45_A	49_A	0.673	0.53
94_V	103_A	0.672	0.53
2_E	6_F	0.672	0.53
39_P	97_V	0.672	0.53
4_E	35_S	0.665	0.52
4_E	20_R	0.661	0.52
44_Q	48_I	0.654	0.51
86_V	94_V	0.650	0.51
29_R	32_A	0.649	0.51
40_A	101_A	0.644	0.50
30_L	60_A	0.640	0.50
74_D	77_Q	0.639	0.50
49_A	88_F	0.638	0.49
67_Q	77_Q	0.637	0.49
41_D	45_A	0.636	0.49
14_T	19_V	0.635	0.49
39_P	100_V	0.633	0.49
89_D	107_Y	0.631	0.49
17_A	100_V	0.629	0.48
63_Q	67_Q	0.621	0.48
30_L	65_L	0.618	0.47
25_D	72_V	0.608	0.46
38_L	52_R	0.604	0.46
56_P	59_A	0.598	0.45
31_E	74_D	0.596	0.45
40_A	43_E	0.594	0.45
107_Y	110_W	0.594	0.45
52_R	90_G	0.588	0.44
15_A	63_Q	0.583	0.43
75_A	94_V	0.581	0.43
10_A	17_A	0.573	0.42
47_A	60_A	0.564	0.41
4_E	11_H	0.563	0.41
14_T	104_L	0.560	0.41
55_S	94_V	0.559	0.41
12_P	24_L	0.558	0.41
53_L	56_P	0.557	0.41
67_Q	70_Q	0.553	0.40
6_F	20_R	0.549	0.40
34_L	49_A	0.536	0.38
50_Q	69_Y	0.536	0.38
42_P	45_A	0.535	0.38
63_Q	66_A	0.535	0.38
70_Q	74_D	0.534	0.38
62_Q	112_R	0.529	0.38
88_F	94_V	0.528	0.38
68_A	72_V	0.527	0.38
23_E	73_A	0.526	0.37
88_F	104_L	0.524	0.37
29_R	40_A	0.518	0.37
20_R	24_L	0.513	0.36
56_P	61_L	0.503	0.35
70_Q	77_Q	0.501	0.35
10_A	15_A	0.501	0.35
70_Q	73_A	0.500	0.35
96_G	99_D	0.500	0.35

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ktbA	5	0.8496	85.8	0.855	Contact Map
3kgkA	2	0.7965	84.3	0.858	Contact Map
3gl5A	2	0.9027	81.5	0.862	Contact Map
3c7mA	1	0.9115	75	0.87	Contact Map
3gv1A	2	0.9912	73.2	0.872	Contact Map
4p3yB	1	0.9115	72.7	0.872	Contact Map
3ghaA	1	0.9292	71.7	0.873	Contact Map
1un2A	1	0.708	71.3	0.874	Contact Map
4od7A	1	0.9469	71.2	0.874	Contact Map
2znmA	3	0.9204	71.2	0.874	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.