DUF1524 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1524 - Protein of unknown function (DUF1524)

PFAM:	PF07510	Sequences: FPRDDEFRRALKTKDLYNGRRRRLRYILEGRLENDLRTGEEIDFDPGKLTIEHILPQNPAWEWEGLGEWDEEEREEYLHRLGNLTLLSGSLNSSLSNKPFLEKKKGYKKSCLYLNRELAVKDEWTEEEIEARQEALAEW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	139 (135)
Sequences:	19628 (15930)
Seq/√Len:	1371.0
META:	0.831

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
125_T	128_E	4.370	1.00
80_R	133_Q	3.212	1.00
98_K	102_E	2.741	1.00
121_K	128_E	2.613	1.00
77_Y	130_E	2.193	1.00
88_S	91_L	2.142	1.00
87_L	95_L	1.999	1.00
99_P	102_E	1.987	1.00
117_E	135_A	1.980	1.00
100_F	104_K	1.963	1.00
89_G	93_S	1.906	1.00
106_G	109_K	1.847	1.00
70_D	73_E	1.823	1.00
77_Y	80_R	1.780	1.00
85_T	115_N	1.768	1.00
9_R	13_T	1.700	1.00
113_Y	116_R	1.677	1.00
126_E	130_E	1.632	1.00
74_R	78_L	1.606	1.00
73_E	126_E	1.591	1.00
25_R	29_E	1.587	1.00
123_E	128_E	1.559	1.00
82_G	129_I	1.558	1.00
12_K	134_E	1.482	1.00
3_R	6_E	1.479	1.00
57_Q	78_L	1.471	1.00
8_R	12_K	1.461	1.00
58_N	97_N	1.459	1.00
5_D	9_R	1.452	1.00
55_L	74_R	1.417	1.00
8_R	138_E	1.397	1.00
59_P	63_W	1.392	1.00
77_Y	126_E	1.392	1.00
133_Q	137_A	1.381	1.00
53_H	92_N	1.369	1.00
11_L	137_A	1.368	1.00
52_E	103_K	1.368	1.00
93_S	96_S	1.357	1.00
79_H	84_L	1.353	1.00
127_E	131_A	1.351	1.00
57_Q	79_H	1.314	1.00
33_E	37_R	1.263	1.00
112_L	115_N	1.262	1.00
59_P	74_R	1.258	1.00
41_E	44_F	1.255	1.00
95_L	106_G	1.254	1.00
85_T	114_L	1.228	1.00
55_L	124_W	1.215	1.00
55_L	129_I	1.212	1.00
26_Y	31_R	1.202	1.00
59_P	97_N	1.199	1.00
131_A	135_A	1.198	1.00
115_N	119_A	1.160	1.00
115_N	118_L	1.155	1.00
51_I	84_L	1.146	1.00
121_K	131_A	1.129	1.00
80_R	130_E	1.125	1.00
50_T	93_S	1.113	1.00
15_D	18_N	1.105	1.00
10_A	13_T	1.088	1.00
72_E	76_E	1.083	1.00
7_F	11_L	1.071	1.00
128_E	131_A	1.063	1.00
32_L	36_L	1.056	1.00
87_L	91_L	1.052	1.00
52_E	95_L	1.038	1.00
40_E	43_D	1.036	1.00
42_I	45_D	1.032	1.00
24_L	51_I	1.029	1.00
69_W	73_E	1.025	1.00
117_E	121_K	1.014	1.00
100_F	121_K	1.004	1.00
46_P	49_L	1.004	1.00
55_L	59_P	1.004	1.00
114_L	136_L	1.000	1.00
130_E	134_E	0.995	1.00
34_N	37_R	0.992	1.00
54_I	100_F	0.989	1.00
105_K	108_K	0.983	1.00
47_G	50_T	0.974	1.00
91_L	103_K	0.969	1.00
59_P	62_E	0.964	1.00
46_P	50_T	0.953	1.00
102_E	105_K	0.948	1.00
6_E	9_R	0.947	1.00
24_L	28_L	0.946	1.00
69_W	72_E	0.936	1.00
77_Y	83_N	0.919	1.00
50_T	89_G	0.901	1.00
132_R	136_L	0.901	1.00
116_R	119_A	0.899	1.00
9_R	12_K	0.896	1.00
113_Y	117_E	0.889	1.00
108_K	119_A	0.885	1.00
5_D	8_R	0.885	1.00
11_L	81_L	0.879	1.00
85_T	118_L	0.862	1.00
23_R	26_Y	0.862	1.00
67_G	70_D	0.857	1.00
114_L	117_E	0.846	1.00
114_L	118_L	0.845	1.00
71_E	75_E	0.844	1.00
110_S	115_N	0.834	1.00
62_E	99_P	0.832	1.00
73_E	77_Y	0.827	1.00
6_E	10_A	0.822	1.00
131_A	134_E	0.821	1.00
54_I	85_T	0.815	1.00
17_Y	79_H	0.810	1.00
88_S	110_S	0.808	1.00
31_R	34_N	0.807	1.00
37_R	111_C	0.804	1.00
33_E	36_L	0.795	1.00
82_G	119_A	0.793	1.00
66_L	69_W	0.792	1.00
36_L	117_E	0.791	1.00
104_K	122_D	0.791	1.00
82_G	133_Q	0.788	1.00
19_G	22_R	0.786	1.00
45_D	49_L	0.783	1.00
65_G	69_W	0.778	1.00
42_I	46_P	0.776	1.00
25_R	28_L	0.765	1.00
40_E	44_F	0.763	1.00
112_L	116_R	0.763	1.00
130_E	133_Q	0.756	1.00
66_L	70_D	0.756	1.00
23_R	27_I	0.754	1.00
16_L	19_G	0.752	1.00
101_L	104_K	0.752	1.00
83_N	129_I	0.745	1.00
90_S	93_S	0.742	1.00
73_E	76_E	0.737	1.00
8_R	137_A	0.735	1.00
38_T	91_L	0.734	1.00
41_E	45_D	0.734	1.00
94_S	106_G	0.731	1.00
110_S	113_Y	0.727	1.00
12_K	15_D	0.721	1.00
29_E	34_N	0.717	1.00
20_R	23_R	0.717	1.00
127_E	130_E	0.713	1.00
111_C	115_N	0.707	1.00
111_C	116_R	0.705	1.00
14_K	17_Y	0.694	1.00
118_L	121_K	0.677	1.00
36_L	39_G	0.674	1.00
64_E	67_G	0.663	1.00
82_G	123_E	0.661	1.00
101_L	105_K	0.657	1.00
100_F	103_K	0.657	1.00
77_Y	129_I	0.656	1.00
26_Y	29_E	0.656	1.00
65_G	123_E	0.656	1.00
40_E	45_D	0.656	1.00
111_C	114_L	0.652	1.00
45_D	48_K	0.649	1.00
14_K	19_G	0.647	1.00
110_S	114_L	0.646	1.00
34_N	38_T	0.642	1.00
43_D	46_P	0.641	1.00
75_E	78_L	0.636	1.00
95_L	103_K	0.634	1.00
23_R	29_E	0.632	1.00
102_E	106_G	0.629	1.00
18_N	21_R	0.619	1.00
95_L	107_Y	0.618	1.00
15_D	20_R	0.613	1.00
134_E	138_E	0.613	1.00
16_L	21_R	0.610	1.00
8_R	134_E	0.609	1.00
58_N	62_E	0.607	1.00
81_L	133_Q	0.605	1.00
95_L	99_P	0.600	1.00
64_E	68_E	0.597	1.00
18_N	22_R	0.587	1.00
111_C	117_E	0.581	1.00
129_I	133_Q	0.578	1.00
135_A	138_E	0.571	1.00
71_E	74_R	0.565	1.00
76_E	126_E	0.564	1.00
17_Y	20_R	0.562	1.00
98_K	106_G	0.555	1.00
56_P	83_N	0.553	1.00
91_L	95_L	0.547	1.00
74_R	77_Y	0.547	1.00
70_D	74_R	0.543	1.00
11_L	14_K	0.543	1.00
54_I	107_Y	0.542	1.00
12_K	137_A	0.539	1.00
113_Y	118_L	0.537	1.00
28_L	86_L	0.535	1.00
44_F	48_K	0.534	1.00
16_L	20_R	0.526	1.00
24_L	27_I	0.520	1.00
49_L	112_L	0.518	1.00
61_W	74_R	0.513	1.00
121_K	135_A	0.508	1.00
4_D	8_R	0.505	1.00
37_R	41_E	0.503	1.00
55_L	78_L	0.500	1.00
16_L	81_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4un4B	1	0.7914	49	0.859	Contact Map
4ogeA	1	0.8633	39.6	0.867	Contact Map
4h9dA	3	0.6115	22.6	0.882	Contact Map
4uhqA	1	0.6331	13.3	0.894	Contact Map
7ceiB	1	0.5755	12.9	0.894	Contact Map
3m7kA	2	0.7986	5.5	0.91	Contact Map
1fr2B	1	0.554	5.3	0.911	Contact Map
3zfkA	1	0.5468	5.3	0.911	Contact Map
4qkoB	2	0.5683	3.1	0.921	Contact Map
2pu3A	1	0.9712	2.8	0.922	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.