W_rich_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

W_rich_C - Tryptophan-rich Synechocystis species C-terminal domain

PFAM:	PF07483	Sequences: TSLVQVGNNYYLLPDGGGSGPELKYGGAPVVAGQFGGWTPIGAEQTAGGYEVAWKNAGADQYTVWNTDSNGNYVSNLGGVVSGSSAALSLETSFHQDLNGDGVIG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	105 (98)
Sequences:	5813 (4299)
Seq/√Len:	434.3
META:	0.965

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
66_N	77_L	2.703	1.00
14_P	17_G	2.275	1.00
10_Y	13_L	2.210	1.00
73_Y	76_N	2.180	1.00
51_E	93_S	2.174	1.00
25_Y	35_F	2.137	1.00
24_K	72_N	2.130	1.00
90_L	93_S	2.023	1.00
31_V	34_Q	1.989	1.00
51_E	66_N	1.984	1.00
22_E	29_P	1.947	1.00
42_G	96_Q	1.941	1.00
13_L	18_G	1.894	1.00
52_V	67_T	1.890	1.00
64_V	90_L	1.887	1.00
56_N	60_D	1.884	1.00
68_D	72_N	1.855	1.00
30_V	35_F	1.738	1.00
44_E	95_H	1.637	1.00
63_T	76_N	1.588	1.00
85_S	88_L	1.563	1.00
10_Y	14_P	1.543	1.00
56_N	59_A	1.539	1.00
89_S	92_T	1.421	1.00
61_Q	80_V	1.415	1.00
37_G	56_N	1.414	1.00
83_G	87_A	1.414	1.00
86_A	89_S	1.400	1.00
50_Y	71_G	1.367	1.00
24_K	29_P	1.364	1.00
40_P	54_W	1.328	1.00
10_Y	29_P	1.326	1.00
54_W	73_Y	1.310	1.00
81_V	85_S	1.307	1.00
10_Y	15_D	1.304	1.00
38_W	56_N	1.283	1.00
81_V	88_L	1.274	1.00
55_K	59_A	1.256	1.00
78_G	81_V	1.243	1.00
23_L	67_T	1.225	1.00
53_A	98_L	1.184	1.00
8_N	13_L	1.157	1.00
51_E	77_L	1.136	1.00
23_L	52_V	1.100	1.00
14_P	18_G	1.100	1.00
92_T	95_H	1.086	1.00
15_D	18_G	1.061	1.00
40_P	43_A	1.058	1.00
45_Q	49_G	1.056	1.00
82_S	85_S	1.052	1.00
44_E	93_S	1.038	1.00
39_T	57_A	1.028	1.00
95_H	103_V	1.026	1.00
10_Y	22_E	1.018	1.00
15_D	19_S	1.010	1.00
83_G	88_L	1.007	1.00
66_N	75_S	0.999	1.00
45_Q	69_S	0.987	1.00
63_T	73_Y	0.977	1.00
9_N	22_E	0.961	1.00
77_L	80_V	0.927	1.00
46_T	51_E	0.921	1.00
63_T	78_G	0.917	1.00
56_N	61_Q	0.915	1.00
12_L	15_D	0.905	1.00
25_Y	28_A	0.883	1.00
66_N	74_V	0.873	1.00
8_N	11_Y	0.871	1.00
51_E	90_L	0.868	1.00
40_P	52_V	0.856	1.00
81_V	87_A	0.853	1.00
11_Y	14_P	0.837	1.00
64_V	94_F	0.834	1.00
73_Y	77_L	0.831	1.00
53_A	64_V	0.824	1.00
12_L	22_E	0.821	1.00
11_Y	22_E	0.808	1.00
46_T	49_G	0.797	1.00
44_E	96_Q	0.795	1.00
11_Y	15_D	0.785	1.00
60_D	84_S	0.785	1.00
57_A	60_D	0.781	1.00
31_V	35_F	0.757	1.00
10_Y	16_G	0.755	1.00
43_A	52_V	0.752	1.00
13_L	19_S	0.747	1.00
27_G	72_N	0.738	1.00
64_V	78_G	0.728	1.00
55_K	100_G	0.723	1.00
14_P	20_G	0.718	1.00
9_N	14_P	0.705	1.00
30_V	54_W	0.698	1.00
8_N	14_P	0.698	1.00
49_G	71_G	0.696	1.00
79_G	82_S	0.681	1.00
25_Y	34_Q	0.670	1.00
13_L	17_G	0.666	1.00
8_N	12_L	0.665	1.00
97_D	104_I	0.655	0.99
78_G	90_L	0.652	0.99
12_L	23_L	0.652	0.99
9_N	29_P	0.652	0.99
45_Q	50_Y	0.650	0.99
91_E	97_D	0.644	0.99
12_L	17_G	0.644	0.99
14_P	19_S	0.640	0.99
67_T	71_G	0.637	0.99
28_A	34_Q	0.636	0.99
46_T	93_S	0.629	0.99
38_W	76_N	0.627	0.99
24_K	70_N	0.627	0.99
90_L	94_F	0.625	0.99
35_F	63_T	0.622	0.99
53_A	90_L	0.613	0.99
101_D	105_G	0.613	0.99
89_S	93_S	0.603	0.99
59_A	62_Y	0.601	0.99
38_W	65_W	0.596	0.99
87_A	90_L	0.596	0.99
100_G	103_V	0.595	0.99
82_S	88_L	0.584	0.99
8_N	15_D	0.583	0.99
64_V	77_L	0.576	0.99
41_I	55_K	0.576	0.99
55_K	62_Y	0.572	0.99
13_L	21_P	0.571	0.99
82_S	86_A	0.566	0.99
9_N	13_L	0.557	0.98
44_E	51_E	0.555	0.98
62_Y	98_L	0.554	0.98
97_D	101_D	0.553	0.98
53_A	96_Q	0.552	0.98
45_Q	48_G	0.552	0.98
12_L	16_G	0.551	0.98
91_E	94_F	0.551	0.98
94_F	98_L	0.543	0.98
35_F	54_W	0.540	0.98
46_T	66_N	0.531	0.98
51_E	64_V	0.531	0.98
27_G	31_V	0.530	0.98
30_V	67_T	0.519	0.97
37_G	57_A	0.514	0.97
25_Y	73_Y	0.514	0.97
39_T	55_K	0.513	0.97
63_T	77_L	0.507	0.97
34_Q	40_P	0.506	0.97
12_L	21_P	0.500	0.97

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4irzA	1	0.9714	25.7	0.882	Contact Map
3ijeA	1	0.9619	25.2	0.883	Contact Map
4nehA	1	0.9619	24.7	0.883	Contact Map
4tqjA	2	0.8857	15.5	0.894	Contact Map
4o9xA	1	0.981	15.2	0.894	Contact Map
4iglA	1	0.981	15	0.895	Contact Map
3vi3A	1	0.9714	13.6	0.896	Contact Map
4um9A	1	0.981	12.9	0.897	Contact Map
4wk0A	1	0.981	11.5	0.899	Contact Map
3fcsA	2	0.981	9.5	0.903	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.