DUF1522 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1522 - Domain of Unknown Function (DUF1522)

PFAM:	PF07482	Sequences: STLTVNGKTITFKNAAAPAAAAVPTGSGVSGNVVTDGNGNSTVYLGTGTVGDVLTAIDLASGVQTATIASGAATLTTASGQTASSIIASGALTLSTGTGADLSITGKADA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	110 (110)
Sequences:	795 (394)
Seq/√Len:	37.6
META:	0.883

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
67_T	76_T	4.750	1.00
27_S	34_V	3.182	1.00
55_T	75_L	3.103	1.00
69_A	74_T	3.012	1.00
64_Q	75_L	2.732	1.00
78_A	81_Q	2.653	1.00
34_V	42_T	2.541	1.00
55_T	64_Q	2.477	1.00
67_T	74_T	2.295	1.00
33_V	41_S	2.226	0.99
100_A	103_S	2.214	0.99
68_I	72_A	2.195	0.99
5_V	10_I	2.123	0.99
51_G	55_T	1.836	0.98
59_L	66_A	1.742	0.97
37_G	59_L	1.737	0.97
3_L	12_F	1.640	0.95
30_S	72_A	1.585	0.94
23_V	34_V	1.580	0.94
19_A	22_A	1.550	0.94
26_G	34_V	1.541	0.93
23_V	27_S	1.500	0.92
1_S	4_T	1.486	0.92
100_A	105_T	1.463	0.91
17_A	47_T	1.435	0.91
23_V	26_G	1.430	0.90
64_Q	83_A	1.429	0.90
30_S	75_L	1.407	0.90
99_G	109_D	1.386	0.89
24_P	27_S	1.386	0.89
81_Q	84_S	1.360	0.88
6_N	9_T	1.333	0.87
88_A	93_T	1.325	0.87
28_G	66_A	1.320	0.86
45_L	110_A	1.307	0.86
77_T	83_A	1.301	0.86
53_V	57_I	1.299	0.86
15_A	46_G	1.266	0.84
65_T	78_A	1.243	0.83
12_F	57_I	1.199	0.81
87_I	91_A	1.197	0.80
17_A	29_V	1.165	0.79
98_T	101_D	1.132	0.77
96_T	104_I	1.117	0.76
14_N	48_G	1.064	0.72
99_G	108_A	1.049	0.71
47_T	53_V	1.046	0.71
37_G	66_A	1.042	0.70
33_V	75_L	1.039	0.70
64_Q	77_T	1.028	0.69
59_L	73_A	1.013	0.68
95_S	104_I	1.004	0.67
61_S	97_G	0.998	0.67
18_P	43_V	0.998	0.67
66_A	73_A	0.978	0.65
68_I	71_G	0.957	0.64
92_L	104_I	0.956	0.64
18_P	44_Y	0.954	0.63
27_S	42_T	0.950	0.63
16_A	19_A	0.941	0.62
63_V	81_Q	0.931	0.62
69_A	73_A	0.920	0.61
20_A	23_V	0.906	0.59
61_S	99_G	0.900	0.59
45_L	96_T	0.886	0.58
93_T	99_G	0.874	0.57
54_L	92_L	0.864	0.56
15_A	43_V	0.853	0.55
46_G	93_T	0.837	0.53
97_G	102_L	0.832	0.53
33_V	42_T	0.819	0.52
93_T	97_G	0.810	0.51
30_S	74_T	0.809	0.51
1_S	15_A	0.806	0.51
4_T	15_A	0.800	0.50
6_N	14_N	0.791	0.49
72_A	76_T	0.784	0.49
28_G	73_A	0.781	0.48
27_S	71_G	0.779	0.48
51_G	65_T	0.772	0.48
88_A	106_G	0.768	0.47
35_T	68_I	0.768	0.47
65_T	77_T	0.763	0.47
28_G	68_I	0.762	0.47
4_T	9_T	0.759	0.46
31_G	55_T	0.755	0.46
77_T	84_S	0.737	0.45
61_S	96_T	0.736	0.44
23_V	72_A	0.735	0.44
91_A	106_G	0.733	0.44
23_V	28_G	0.727	0.44
46_G	53_V	0.725	0.43
72_A	104_I	0.725	0.43
48_G	53_V	0.718	0.43
61_S	106_G	0.708	0.42
4_T	100_A	0.707	0.42
86_I	89_S	0.703	0.42
86_I	93_T	0.702	0.41
65_T	68_I	0.697	0.41
35_T	52_D	0.697	0.41
6_N	22_A	0.688	0.40
3_L	57_I	0.687	0.40
26_G	68_I	0.682	0.40
64_Q	76_T	0.680	0.40
15_A	49_T	0.676	0.39
16_A	48_G	0.676	0.39
8_K	91_A	0.675	0.39
26_G	30_S	0.674	0.39
97_G	108_A	0.669	0.39
84_S	104_I	0.665	0.38
77_T	82_T	0.664	0.38
47_T	50_V	0.660	0.38
33_V	64_Q	0.659	0.38
92_L	95_S	0.652	0.37
50_V	68_I	0.651	0.37
6_N	63_V	0.646	0.37
14_N	46_G	0.643	0.36
95_S	108_A	0.638	0.36
16_A	63_V	0.638	0.36
7_G	10_I	0.636	0.36
43_V	64_Q	0.633	0.36
50_V	53_V	0.632	0.36
30_S	33_V	0.630	0.35
6_N	40_N	0.627	0.35
9_T	13_K	0.623	0.35
34_V	68_I	0.620	0.35
93_T	98_T	0.611	0.34
82_T	106_G	0.607	0.34
43_V	78_A	0.606	0.33
89_S	98_T	0.606	0.33
91_A	105_T	0.599	0.33
97_G	101_D	0.595	0.33
10_I	24_P	0.594	0.33
29_V	32_N	0.593	0.32
40_N	53_V	0.592	0.32
28_G	76_T	0.586	0.32
107_K	110_A	0.582	0.32
19_A	27_S	0.581	0.32
99_G	105_T	0.578	0.31
79_S	82_T	0.576	0.31
98_T	102_L	0.568	0.31
29_V	34_V	0.564	0.30
9_T	14_N	0.553	0.29
99_G	106_G	0.544	0.29
92_L	97_G	0.544	0.29
4_T	46_G	0.537	0.28
33_V	65_T	0.533	0.28
24_P	28_G	0.532	0.28
27_S	68_I	0.526	0.27
3_L	13_K	0.526	0.27
94_L	106_G	0.525	0.27
106_G	109_D	0.523	0.27
33_V	66_A	0.515	0.27
50_V	87_I	0.514	0.27
68_I	73_A	0.512	0.26
18_P	63_V	0.510	0.26
48_G	107_K	0.509	0.26
21_A	32_N	0.507	0.26
95_S	109_D	0.507	0.26
4_T	14_N	0.507	0.26
87_I	93_T	0.507	0.26
2_T	38_N	0.506	0.26
20_A	72_A	0.502	0.26
2_T	8_K	0.501	0.26
33_V	72_A	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4peuA	1	0.8636	13.7	0.933	Contact Map
1b5fA	2	0.4091	4.4	0.946	Contact Map
1yduA	1	0.3091	3.8	0.948	Contact Map
4mtkA	4	0.8	3.1	0.95	Contact Map
1qcxA	1	0.7455	2.9	0.951	Contact Map
1lmiA	1	0.5091	2.5	0.952	Contact Map
1pclA	1	0.8	2.5	0.953	Contact Map
2l7yA	1	0.2273	2.2	0.954	Contact Map
3syjA	2	0.8	2	0.955	Contact Map
3szeA	1	0.8	1.9	0.955	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.