CHRD - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CHRD - CHRD domain

PFAM:	PF07452	Sequences: FTATLSGAQEVPPAVDSTATGTATVTLDTDGGTLTYTLTFSGLTAAHIHGGAAGVNGPVVVPLTGPGGGGGAAQVAALLAGNLYVNVHTAAFPGGEIRGQL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	101 (100)
Sequences:	38414 (28298)
Seq/√Len:	2829.8
META:	0.965

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
6_S	9_Q	3.018	1.00
48_I	83_L	2.582	1.00
47_H	88_H	2.470	1.00
11_V	56_N	2.415	1.00
10_E	86_N	2.212	1.00
50_G	77_A	2.159	1.00
78_L	83_L	1.893	1.00
45_A	62_P	1.845	1.00
50_G	60_V	1.837	1.00
23_A	38_L	1.837	1.00
3_A	99_G	1.821	1.00
32_G	75_V	1.686	1.00
23_A	85_V	1.669	1.00
49_H	88_H	1.665	1.00
77_A	82_N	1.658	1.00
77_A	83_L	1.649	1.00
60_V	74_Q	1.636	1.00
76_A	80_A	1.522	1.00
40_F	87_V	1.490	1.00
4_T	22_T	1.488	1.00
48_I	101_L	1.474	1.00
11_V	54_G	1.407	1.00
61_V	74_Q	1.406	1.00
9_Q	53_A	1.376	1.00
27_L	75_V	1.365	1.00
60_V	83_L	1.356	1.00
15_V	92_F	1.354	1.00
72_A	76_A	1.338	1.00
75_V	79_L	1.322	1.00
52_A	55_V	1.299	1.00
28_D	31_G	1.297	1.00
66_P	69_G	1.297	1.00
20_T	41_S	1.287	1.00
50_G	83_L	1.284	1.00
24_T	37_T	1.232	1.00
63_L	85_V	1.198	1.00
74_Q	77_A	1.175	1.00
73_A	77_A	1.167	1.00
25_V	85_V	1.166	1.00
28_D	33_T	1.161	1.00
92_F	96_E	1.160	1.00
74_Q	83_L	1.156	1.00
68_G	71_G	1.156	1.00
46_A	87_V	1.125	1.00
44_T	90_A	1.123	1.00
40_F	43_L	1.121	1.00
25_V	36_Y	1.115	1.00
67_G	71_G	1.113	1.00
32_G	72_A	1.108	1.00
52_A	82_N	1.106	1.00
47_H	59_V	1.104	1.00
7_G	15_V	1.070	1.00
36_Y	48_I	1.062	1.00
31_G	79_L	1.047	1.00
67_G	70_G	1.041	1.00
89_T	96_E	1.027	1.00
11_V	14_A	1.016	1.00
59_V	62_P	1.013	1.00
25_V	34_L	1.002	1.00
15_V	18_T	1.002	1.00
5_L	85_V	0.991	1.00
3_A	25_V	0.983	1.00
50_G	82_N	0.982	1.00
90_A	93_P	0.972	1.00
50_G	57_G	0.951	1.00
48_I	63_L	0.940	1.00
27_L	34_L	0.936	1.00
51_G	57_G	0.929	1.00
5_L	21_G	0.928	1.00
64_T	67_G	0.928	1.00
22_T	39_T	0.927	1.00
26_T	35_T	0.884	1.00
49_H	86_N	0.882	1.00
65_G	70_G	0.879	1.00
7_G	17_S	0.861	1.00
62_P	65_G	0.858	1.00
19_A	43_L	0.856	1.00
28_D	32_G	0.856	1.00
73_A	76_A	0.855	1.00
2_T	22_T	0.845	1.00
74_Q	78_L	0.824	1.00
76_A	79_L	0.822	1.00
49_H	58_P	0.821	1.00
17_S	96_E	0.820	1.00
9_Q	54_G	0.818	1.00
49_H	59_V	0.799	1.00
66_P	70_G	0.784	1.00
51_G	82_N	0.780	1.00
84_Y	98_R	0.773	1.00
45_A	59_V	0.769	1.00
44_T	89_T	0.769	1.00
19_A	97_I	0.760	1.00
2_T	24_T	0.753	1.00
89_T	92_F	0.751	1.00
72_A	75_V	0.745	1.00
3_A	23_A	0.742	1.00
36_Y	85_V	0.723	1.00
77_A	80_A	0.719	1.00
47_H	86_N	0.718	1.00
51_G	100_Q	0.717	1.00
24_T	39_T	0.715	1.00
13_P	16_D	0.711	1.00
50_G	74_Q	0.693	1.00
27_L	31_G	0.683	1.00
5_L	87_V	0.683	1.00
65_G	69_G	0.679	1.00
57_G	60_V	0.679	1.00
4_T	20_T	0.678	1.00
64_T	71_G	0.678	1.00
62_P	67_G	0.674	1.00
89_T	95_G	0.673	1.00
51_G	77_A	0.672	1.00
40_F	64_T	0.660	1.00
46_A	63_L	0.653	1.00
53_A	100_Q	0.651	1.00
36_Y	64_T	0.647	1.00
47_H	62_P	0.646	1.00
44_T	93_P	0.644	1.00
48_I	61_V	0.643	1.00
66_P	71_G	0.641	1.00
12_P	56_N	0.640	1.00
35_T	83_L	0.622	1.00
27_L	32_G	0.607	1.00
27_L	79_L	0.604	1.00
38_L	85_V	0.596	1.00
26_T	37_T	0.594	1.00
5_L	97_I	0.593	1.00
45_A	88_H	0.590	1.00
36_Y	61_V	0.586	1.00
27_L	78_L	0.584	1.00
21_G	87_V	0.582	1.00
13_P	18_T	0.581	1.00
10_E	15_V	0.575	1.00
20_T	42_G	0.567	1.00
59_V	88_H	0.563	1.00
25_V	48_I	0.560	1.00
8_A	16_D	0.559	1.00
16_D	92_F	0.558	1.00
22_T	37_T	0.546	1.00
28_D	35_T	0.541	1.00
84_Y	88_H	0.524	1.00
14_A	18_T	0.518	1.00
86_N	98_R	0.516	1.00
65_G	68_G	0.515	1.00
26_T	29_T	0.513	1.00
23_A	26_T	0.509	1.00
38_L	87_V	0.507	1.00
52_A	57_G	0.507	1.00
23_A	36_Y	0.506	1.00
29_T	32_G	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1u9yA	3	0.3861	7.4	0.896	Contact Map
4twbA	2	0.3861	6.7	0.898	Contact Map
3lrtA	2	0.3861	6	0.9	Contact Map
1wscA	1	0.7129	6	0.9	Contact Map
3s5jB	2	0.396	5.4	0.902	Contact Map
2j6pA	4	0.3663	4.4	0.906	Contact Map
2vvfA	3	0.9307	4.2	0.907	Contact Map
3dahA	5	0.4059	3.7	0.91	Contact Map
4bczA	1	0.7822	3.4	0.911	Contact Map
1d0nA	5	0.5644	2.9	0.915	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.