Glyco_hydro_75 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Glyco_hydro_75 - Fungal chitosanase of glycosyl hydrolase group 75

PFAM:	PF07335	Sequences: MDIDCDGSDGDRGGCGTDPDFQPQTSFRDSVQSWGIRDLDAETDPYIVLPGPSSIFDYRAHGIPGGGDYAVVYNGKVYYAIVGDTNGDGPSDKIGEASYALAKALFGIDPPDPRRGGSDSGVTYIVFPGSAAVPPPDLAAWNAKAAAEFEKSIKSLGDKLVAR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	163 (135)
Sequences:	1282 (872)
Seq/√Len:	75.1
META:	0.739

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
39_L	83_G	6.253	1.00
97_A	101_L	5.492	1.00
80_A	101_L	4.017	1.00
24_Q	28_R	3.544	1.00
26_S	85_T	2.914	1.00
51_G	85_T	2.615	1.00
110_P	115_R	2.612	1.00
117_G	121_G	2.596	1.00
1_M	124_Y	2.306	1.00
47_I	69_Y	2.280	1.00
112_D	115_R	2.140	1.00
97_A	124_Y	2.090	1.00
118_S	121_G	1.981	1.00
28_R	38_D	1.969	1.00
113_P	116_G	1.851	1.00
3_I	102_A	1.782	1.00
70_A	80_A	1.771	1.00
17_T	20_D	1.763	1.00
49_L	82_V	1.758	1.00
49_L	126_V	1.751	1.00
22_Q	25_T	1.706	1.00
100_A	104_A	1.662	1.00
69_Y	126_V	1.647	1.00
78_Y	104_A	1.646	1.00
8_S	40_D	1.613	1.00
107_G	113_P	1.593	0.99
63_I	126_V	1.571	0.99
71_V	101_L	1.505	0.99
111_P	115_R	1.453	0.99
14_G	42_E	1.436	0.99
16_G	19_P	1.430	0.99
10_G	42_E	1.404	0.99
5_C	15_C	1.376	0.98
18_D	21_F	1.368	0.98
78_Y	101_L	1.352	0.98
82_V	126_V	1.347	0.98
27_F	65_G	1.337	0.98
40_D	43_T	1.326	0.98
63_I	82_V	1.323	0.98
70_A	79_Y	1.283	0.98
64_P	67_G	1.223	0.97
90_P	93_K	1.217	0.97
17_T	21_F	1.210	0.96
129_G	133_V	1.185	0.96
137_D	140_A	1.183	0.96
102_A	116_G	1.162	0.96
35_G	38_D	1.144	0.95
47_I	83_G	1.130	0.95
110_P	113_P	1.117	0.94
110_P	116_G	1.089	0.94
136_P	141_W	1.060	0.93
20_D	114_R	1.060	0.93
4_D	46_Y	1.048	0.92
47_I	70_A	1.035	0.92
9_D	12_R	1.031	0.92
138_L	141_W	1.022	0.91
67_G	126_V	1.016	0.91
22_Q	26_S	1.013	0.91
100_A	103_K	1.006	0.91
71_V	127_F	0.983	0.90
135_P	140_A	0.975	0.89
66_G	73_Y	0.966	0.89
138_L	142_N	0.963	0.89
63_I	68_D	0.963	0.89
57_D	60_A	0.960	0.89
102_A	108_I	0.957	0.88
47_I	126_V	0.949	0.88
54_S	57_D	0.949	0.88
68_D	130_S	0.905	0.85
9_D	23_P	0.902	0.85
32_Q	35_G	0.889	0.84
80_A	97_A	0.887	0.84
108_I	116_G	0.885	0.84
135_P	138_L	0.874	0.83
120_S	123_T	0.869	0.83
47_I	80_A	0.868	0.83
64_P	130_S	0.868	0.83
48_V	96_E	0.865	0.83
137_D	141_W	0.864	0.83
34_W	38_D	0.854	0.82
18_D	25_T	0.852	0.82
65_G	68_D	0.849	0.82
8_S	12_R	0.834	0.80
107_G	111_P	0.818	0.79
4_D	28_R	0.818	0.79
22_Q	27_F	0.814	0.79
64_P	68_D	0.813	0.79
67_G	130_S	0.812	0.79
44_D	83_G	0.811	0.78
38_D	41_A	0.811	0.78
108_I	111_P	0.810	0.78
136_P	140_A	0.803	0.78
46_Y	120_S	0.803	0.78
112_D	116_G	0.802	0.78
70_A	77_V	0.795	0.77
67_G	73_Y	0.792	0.77
59_R	63_I	0.788	0.76
74_N	122_V	0.787	0.76
139_A	143_A	0.779	0.76
9_D	40_D	0.779	0.76
78_Y	97_A	0.776	0.75
62_G	67_G	0.770	0.75
72_V	78_Y	0.761	0.74
9_D	17_T	0.760	0.74
111_P	116_G	0.754	0.73
140_A	143_A	0.750	0.73
135_P	141_W	0.747	0.73
63_I	67_G	0.742	0.72
112_D	117_G	0.739	0.72
67_G	128_P	0.738	0.72
66_G	69_Y	0.733	0.71
16_G	54_S	0.731	0.71
111_P	118_S	0.725	0.70
102_A	110_P	0.722	0.70
2_D	93_K	0.715	0.69
112_D	118_S	0.707	0.68
27_F	34_W	0.702	0.68
129_G	136_P	0.700	0.68
39_L	44_D	0.699	0.68
8_S	128_P	0.696	0.67
12_R	40_D	0.695	0.67
47_I	82_V	0.695	0.67
102_A	124_Y	0.690	0.67
66_G	72_V	0.690	0.67
128_P	133_V	0.685	0.66
27_F	32_Q	0.681	0.65
4_D	24_Q	0.681	0.65
137_D	142_N	0.678	0.65
47_I	72_V	0.676	0.65
24_Q	38_D	0.676	0.65
89_G	93_K	0.672	0.64
56_F	61_H	0.672	0.64
139_A	142_N	0.667	0.64
73_Y	121_G	0.660	0.63
94_I	107_G	0.657	0.63
23_P	27_F	0.650	0.62
136_P	142_N	0.648	0.62
40_D	44_D	0.643	0.61
14_G	103_K	0.643	0.61
18_D	22_Q	0.641	0.61
132_A	136_P	0.641	0.61
51_G	55_I	0.640	0.61
16_G	20_D	0.635	0.60
8_S	11_D	0.635	0.60
60_A	130_S	0.629	0.59
47_I	71_V	0.625	0.59
10_G	49_L	0.621	0.58
71_V	90_P	0.617	0.58
67_G	72_V	0.616	0.58
73_Y	77_V	0.609	0.57
51_G	119_D	0.608	0.57
14_G	40_D	0.608	0.57
4_D	7_G	0.605	0.56
51_G	91_S	0.605	0.56
20_D	113_P	0.604	0.56
99_Y	111_P	0.599	0.56
67_G	70_A	0.597	0.55
26_S	51_G	0.584	0.54
9_D	21_F	0.582	0.54
49_L	129_G	0.576	0.53
56_F	94_I	0.572	0.52
21_F	28_R	0.572	0.52
25_T	33_S	0.570	0.52
4_D	20_D	0.568	0.52
3_I	17_T	0.568	0.52
68_D	73_Y	0.566	0.52
117_G	120_S	0.560	0.51
102_A	113_P	0.559	0.51
52_P	57_D	0.558	0.51
41_A	112_D	0.557	0.50
27_F	134_P	0.555	0.50
13_G	54_S	0.554	0.50
14_G	129_G	0.553	0.50
4_D	84_D	0.551	0.50
71_V	77_V	0.548	0.49
104_A	142_N	0.548	0.49
53_S	114_R	0.544	0.49
128_P	131_A	0.543	0.49
2_D	21_F	0.537	0.48
108_I	112_D	0.537	0.48
5_C	20_D	0.536	0.48
38_D	141_W	0.531	0.47
3_I	42_E	0.530	0.47
48_V	95_G	0.530	0.47
4_D	15_C	0.530	0.47
1_M	97_A	0.526	0.47
36_I	39_L	0.526	0.47
70_A	122_V	0.525	0.46
58_Y	134_P	0.525	0.46
37_R	81_I	0.525	0.46
69_Y	119_D	0.523	0.46
64_P	82_V	0.522	0.46
102_A	118_S	0.517	0.45
76_K	133_V	0.514	0.45
47_I	102_A	0.510	0.45
58_Y	61_H	0.510	0.45
5_C	113_P	0.509	0.44
48_V	97_A	0.504	0.44
117_G	122_V	0.503	0.44
6_D	96_E	0.503	0.44
23_P	26_S	0.502	0.44
67_G	82_V	0.500	0.43

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2l58A	1	0.1595	11.3	0.943	Contact Map
2yqkA	1	0.2086	9	0.946	Contact Map
2cqqA	1	0.2025	6.4	0.95	Contact Map
1wudA	3	0.3742	6.1	0.95	Contact Map
3kdqA	5	0.3804	5.9	0.95	Contact Map
3c4zA	2	0.2577	5.7	0.951	Contact Map
2pokA	2	0.2025	5.1	0.952	Contact Map
3tp4A	2	0.2638	4.3	0.953	Contact Map
2kbwB	1	0.1534	4.3	0.953	Contact Map
2rhfA	1	0.3742	4	0.954	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.