DUF1467 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1467 - Protein of unknown function (DUF1467)

PFAM:	PF07330	Sequences: MSWTSAIAIYFLIWWLVLFAVLPFGVRTQEEAGEVKVPGTDPGAPANPRLGRKLLWTTVVAAVLFALIYAVIVSGWITLDDLD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	83 (81)
Sequences:	8255 (4692)
Seq/√Len:	521.4
META:	0.933

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_V	40_T	2.666	1.00
49_R	52_R	2.619	1.00
70_A	74_S	2.409	1.00
10_Y	62_A	2.297	1.00
6_A	65_F	2.282	1.00
51_G	55_L	2.229	1.00
29_Q	40_T	2.006	1.00
69_Y	73_V	1.943	1.00
14_W	58_T	1.828	1.00
68_I	72_I	1.789	1.00
24_F	56_W	1.650	1.00
5_S	8_A	1.634	1.00
28_T	43_G	1.570	1.00
65_F	69_Y	1.567	1.00
27_R	32_A	1.558	1.00
78_T	81_D	1.550	1.00
21_V	24_F	1.538	1.00
29_Q	35_V	1.526	1.00
15_W	18_L	1.520	1.00
55_L	59_V	1.476	1.00
32_A	46_A	1.472	1.00
13_I	68_I	1.392	1.00
17_V	57_T	1.388	1.00
50_L	53_K	1.364	1.00
29_Q	34_E	1.345	1.00
11_F	15_W	1.303	1.00
59_V	63_V	1.287	1.00
2_S	5_S	1.282	1.00
13_I	65_F	1.266	1.00
13_I	64_L	1.256	1.00
50_L	54_L	1.235	1.00
52_R	56_W	1.216	1.00
21_V	57_T	1.204	1.00
17_V	60_V	1.183	1.00
3_W	7_I	1.182	1.00
8_A	11_F	1.170	1.00
17_V	64_L	1.161	1.00
48_P	53_K	1.161	1.00
58_T	62_A	1.150	1.00
51_G	54_L	1.142	1.00
66_A	70_A	1.132	1.00
67_L	71_V	1.121	1.00
71_V	76_W	1.101	1.00
10_Y	58_T	1.079	1.00
8_A	12_L	1.064	1.00
16_L	20_A	1.044	1.00
56_W	59_V	1.021	1.00
20_A	60_V	1.015	1.00
2_S	6_A	0.968	1.00
21_V	56_W	0.960	1.00
28_T	31_E	0.948	1.00
63_V	67_L	0.922	1.00
4_T	7_I	0.919	1.00
75_G	78_T	0.903	1.00
27_R	46_A	0.895	1.00
29_Q	37_V	0.874	1.00
18_L	57_T	0.866	1.00
62_A	65_F	0.852	1.00
35_V	40_T	0.845	1.00
20_A	24_F	0.844	1.00
49_R	53_K	0.841	1.00
17_V	20_A	0.834	1.00
35_V	38_P	0.828	1.00
3_W	6_A	0.818	1.00
34_E	37_V	0.806	1.00
17_V	61_A	0.804	1.00
28_T	41_D	0.800	1.00
70_A	75_G	0.789	1.00
18_L	54_L	0.778	1.00
30_E	35_V	0.771	1.00
52_R	55_L	0.764	1.00
49_R	56_W	0.752	1.00
13_I	17_V	0.751	1.00
29_Q	46_A	0.750	1.00
13_I	16_L	0.747	1.00
71_V	77_I	0.736	1.00
13_I	61_A	0.720	1.00
70_A	73_V	0.705	1.00
79_L	82_L	0.703	1.00
47_N	51_G	0.702	1.00
5_S	9_I	0.690	1.00
30_E	46_A	0.690	1.00
75_G	80_D	0.679	1.00
30_E	42_P	0.673	1.00
71_V	74_S	0.667	1.00
67_L	70_A	0.660	1.00
4_T	8_A	0.656	1.00
6_A	69_Y	0.651	1.00
60_V	63_V	0.633	1.00
74_S	78_T	0.633	1.00
9_I	68_I	0.620	1.00
26_V	43_G	0.616	1.00
56_W	60_V	0.610	1.00
23_P	53_K	0.607	1.00
6_A	9_I	0.600	1.00
70_A	76_W	0.592	0.99
22_L	26_V	0.592	0.99
12_L	16_L	0.583	0.99
53_K	57_T	0.582	0.99
28_T	33_G	0.576	0.99
48_P	51_G	0.572	0.99
18_L	53_K	0.569	0.99
10_Y	61_A	0.567	0.99
19_F	22_L	0.565	0.99
53_K	56_W	0.558	0.99
72_I	75_G	0.554	0.99
29_Q	44_A	0.547	0.99
21_V	60_V	0.545	0.99
20_A	23_P	0.542	0.99
58_T	61_A	0.541	0.99
59_V	62_A	0.535	0.99
71_V	75_G	0.533	0.99
49_R	55_L	0.530	0.99
41_D	44_A	0.529	0.99
77_I	81_D	0.525	0.99
22_L	53_K	0.521	0.99
74_S	77_I	0.520	0.99
17_V	56_W	0.515	0.99
18_L	50_L	0.514	0.98
67_L	76_W	0.511	0.98
54_L	57_T	0.507	0.98
61_A	65_F	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3mk7C	2	1	12.2	0.892	Contact Map
2ww9A	1	0.9398	10.1	0.896	Contact Map
2yevB	1	0.8795	6.8	0.904	Contact Map
4httA	1	0.988	6.2	0.905	Contact Map
4w251	1	0.988	6.2	0.905	Contact Map
3j01A	1	0.9759	5.5	0.908	Contact Map
2zjsY	2	1	4.7	0.911	Contact Map
3b55A	1	0.1205	4.6	0.911	Contact Map
3s8fA	1	0.9759	4.6	0.911	Contact Map
2a3mA	1	0.1446	4	0.914	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.