MauE - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MauE - Methylamine utilisation protein MauE

PFAM:	PF07291	Sequences: MALLIDPVVLLAARLLLALVFAVAALHKLRDPAGFRAALAAYRLLPAALARPVAVLLPAAELAVAVALLLPATRRAAALAAAALLLLFAAAIAINLARGRRDIDCGCFGPGASQPISWWLVARNLVLAALALAVAALPPAARPLSLLDALTGLAAAALLALLYLAADLLLGLPAAARSNSSAKG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	184 (157)
Sequences:	3121 (2777)
Seq/√Len:	221.6
META:	0.88

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_A	65_A	3.764	1.00
21_F	85_L	3.378	1.00
31_D	34_G	3.287	1.00
64_V	81_A	3.213	1.00
67_A	77_A	3.081	1.00
64_V	80_A	2.939	1.00
25_A	62_L	2.912	1.00
64_V	77_A	2.864	1.00
118_W	121_V	2.834	1.00
95_N	100_R	2.655	1.00
14_R	74_R	2.590	1.00
25_A	58_P	2.389	1.00
35_F	39_L	2.140	1.00
27_H	88_F	2.086	1.00
39_L	53_V	2.037	1.00
17_L	131_A	2.034	1.00
39_L	50_A	2.021	1.00
13_A	130_L	2.019	1.00
89_A	128_A	2.006	1.00
45_L	53_V	1.926	1.00
18_A	65_A	1.910	1.00
93_A	121_V	1.869	1.00
94_I	98_R	1.861	1.00
82_A	128_A	1.801	1.00
25_A	65_A	1.725	1.00
70_L	73_T	1.709	1.00
92_I	116_I	1.690	1.00
142_R	148_D	1.682	1.00
42_Y	106_G	1.640	1.00
37_A	41_A	1.612	1.00
74_R	77_A	1.603	1.00
117_S	120_L	1.585	1.00
92_I	120_L	1.582	1.00
36_R	51_R	1.556	1.00
89_A	121_V	1.545	1.00
88_F	108_F	1.544	1.00
38_A	106_G	1.538	1.00
104_D	113_S	1.525	1.00
11_L	14_R	1.519	1.00
138_P	142_R	1.479	1.00
85_L	124_N	1.472	1.00
96_L	99_G	1.394	1.00
55_V	58_P	1.326	1.00
96_L	117_S	1.283	1.00
32_P	55_V	1.282	1.00
49_L	52_P	1.271	1.00
145_S	149_A	1.269	1.00
144_L	148_D	1.254	1.00
89_A	93_A	1.253	1.00
95_N	116_I	1.244	1.00
152_G	156_A	1.219	1.00
32_P	36_R	1.219	1.00
40_A	47_A	1.205	1.00
50_A	54_A	1.182	1.00
103_I	116_I	1.159	1.00
57_L	87_L	1.158	1.00
32_P	58_P	1.153	1.00
36_R	40_A	1.151	1.00
118_W	122_A	1.148	1.00
88_F	92_I	1.145	1.00
17_L	68_L	1.144	1.00
89_A	125_L	1.139	1.00
21_F	81_A	1.100	1.00
18_A	69_L	1.096	1.00
40_A	50_A	1.092	1.00
29_L	62_L	1.090	1.00
15_L	19_L	1.059	1.00
152_G	155_A	1.056	1.00
68_L	81_A	1.047	1.00
18_A	22_A	1.036	1.00
25_A	29_L	1.035	1.00
96_L	101_R	1.033	1.00
104_D	112_A	1.030	1.00
89_A	124_N	1.029	1.00
157_A	163_Y	1.025	1.00
145_S	148_D	1.011	1.00
92_I	95_N	1.011	1.00
120_L	123_R	1.005	1.00
64_V	67_A	1.004	1.00
77_A	80_A	0.989	1.00
45_L	48_A	0.982	1.00
84_L	88_F	0.982	1.00
53_V	87_L	0.980	1.00
95_N	99_G	0.947	1.00
96_L	116_I	0.934	1.00
92_I	124_N	0.927	1.00
68_L	78_A	0.926	1.00
92_I	96_L	0.924	0.99
138_P	143_P	0.911	0.99
156_A	160_A	0.911	0.99
44_L	91_A	0.910	0.99
24_A	27_H	0.905	0.99
41_A	103_I	0.904	0.99
121_V	124_N	0.902	0.99
17_L	81_A	0.901	0.99
91_A	94_I	0.895	0.99
96_L	100_R	0.892	0.99
95_N	98_R	0.889	0.99
132_L	136_A	0.879	0.99
42_Y	91_A	0.876	0.99
96_L	121_V	0.869	0.99
95_N	103_I	0.862	0.99
82_A	132_L	0.853	0.99
46_P	49_L	0.850	0.99
140_A	143_P	0.849	0.99
35_F	54_A	0.845	0.99
34_G	37_A	0.844	0.99
147_L	150_L	0.842	0.99
124_N	128_A	0.841	0.99
34_G	106_G	0.841	0.99
102_D	115_P	0.837	0.99
148_D	151_T	0.835	0.99
35_F	57_L	0.835	0.99
154_A	157_A	0.821	0.99
148_D	152_G	0.821	0.99
21_F	64_V	0.817	0.99
58_P	62_L	0.805	0.99
142_R	146_L	0.799	0.99
83_A	87_L	0.797	0.99
38_A	41_A	0.793	0.98
121_V	125_L	0.792	0.98
21_F	65_A	0.790	0.98
150_L	153_L	0.781	0.98
125_L	129_A	0.770	0.98
82_A	89_A	0.768	0.98
149_A	152_G	0.766	0.98
29_L	58_P	0.764	0.98
133_A	137_L	0.736	0.97
17_L	85_L	0.734	0.97
112_A	116_I	0.730	0.97
116_I	120_L	0.725	0.97
122_A	126_V	0.722	0.97
96_L	103_I	0.721	0.97
143_P	147_L	0.718	0.97
60_A	80_A	0.716	0.97
34_G	38_A	0.716	0.97
86_L	128_A	0.709	0.97
106_G	114_Q	0.703	0.97
42_Y	108_F	0.702	0.97
106_G	120_L	0.701	0.97
52_P	55_V	0.699	0.97
147_L	151_T	0.698	0.97
154_A	158_L	0.695	0.96
85_L	127_L	0.690	0.96
137_L	141_A	0.676	0.96
138_P	141_A	0.675	0.96
9_V	133_A	0.671	0.96
67_A	70_L	0.668	0.96
21_F	124_N	0.666	0.96
85_L	89_A	0.665	0.95
34_G	108_F	0.663	0.95
10_L	14_R	0.663	0.95
36_R	55_V	0.661	0.95
114_Q	120_L	0.659	0.95
156_A	161_L	0.658	0.95
33_A	36_R	0.657	0.95
23_V	27_H	0.646	0.95
151_T	158_L	0.640	0.94
153_L	157_A	0.639	0.94
150_L	154_A	0.638	0.94
158_L	164_L	0.637	0.94
18_A	71_P	0.629	0.94
158_L	163_Y	0.628	0.94
159_L	163_Y	0.626	0.94
130_L	134_V	0.625	0.94
21_F	128_A	0.621	0.94
139_P	143_P	0.617	0.93
126_V	130_L	0.609	0.93
43_R	46_P	0.607	0.93
42_Y	92_I	0.600	0.92
79_L	82_A	0.595	0.92
97_A	118_W	0.594	0.92
76_A	79_L	0.594	0.92
135_A	139_P	0.593	0.92
32_P	59_A	0.593	0.92
24_A	88_F	0.589	0.92
28_K	61_E	0.588	0.92
35_F	58_P	0.587	0.91
67_A	73_T	0.582	0.91
74_R	78_A	0.579	0.91
142_R	151_T	0.577	0.91
53_V	58_P	0.574	0.91
102_D	110_P	0.570	0.90
20_V	88_F	0.569	0.90
27_H	111_G	0.567	0.90
155_A	159_L	0.566	0.90
41_A	112_A	0.565	0.90
35_F	91_A	0.564	0.90
114_Q	117_S	0.564	0.90
13_A	133_A	0.561	0.90
144_L	152_G	0.559	0.89
43_R	98_R	0.559	0.89
92_I	123_R	0.557	0.89
81_A	131_A	0.548	0.88
18_A	72_A	0.548	0.88
71_P	74_R	0.546	0.88
33_A	37_A	0.546	0.88
139_P	142_R	0.545	0.88
42_Y	95_N	0.541	0.88
149_A	156_A	0.540	0.88
91_A	95_N	0.539	0.88
13_A	75_R	0.539	0.88
78_A	134_V	0.538	0.88
131_A	135_A	0.536	0.87
101_R	116_I	0.535	0.87
159_L	164_L	0.533	0.87
128_A	132_L	0.531	0.87
155_A	158_L	0.531	0.87
56_L	59_A	0.530	0.87
149_A	157_A	0.529	0.87
94_I	97_A	0.526	0.86
44_L	94_I	0.524	0.86
39_L	44_L	0.523	0.86
53_V	57_L	0.522	0.86
89_A	92_I	0.521	0.86
90_A	94_I	0.519	0.86
32_P	54_A	0.517	0.85
40_A	100_R	0.516	0.85
149_A	153_L	0.516	0.85
93_A	96_L	0.515	0.85
57_L	61_E	0.511	0.85
158_L	162_L	0.510	0.85
16_L	20_V	0.510	0.85
149_A	154_A	0.510	0.85
29_L	40_A	0.509	0.85
34_G	114_Q	0.509	0.85
45_L	50_A	0.507	0.84
100_R	103_I	0.507	0.84
12_A	155_A	0.506	0.84
153_L	156_A	0.506	0.84
143_P	146_L	0.505	0.84
75_R	139_P	0.505	0.84
152_G	160_A	0.504	0.84
97_A	101_R	0.503	0.84
101_R	118_W	0.502	0.84
17_L	20_V	0.500	0.84

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2a65A	2	0.5598	2.7	0.953	Contact Map
1yk1E	1	0.1087	2.2	0.954	Contact Map
2h3oA	1	0.2391	2	0.956	Contact Map
1yk0E	1	0.1087	1.5	0.959	Contact Map
4k1cA	4	0.9348	1.3	0.961	Contact Map
2l9uA	2	0.212	1.1	0.962	Contact Map
3giaA	1	0.875	1.1	0.962	Contact Map
1sf8A	5	0.2391	1	0.963	Contact Map
1m06J	1	0.0707	1	0.963	Contact Map
2mixA	1	0.1141	0.9	0.963	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.