BCHF - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

BCHF - 2-vinyl bacteriochlorophyllide hydratase (BCHF)

PFAM:	PF07284	Sequences: YTPEERARRDASVWTLVQGVLAPLQFLVFLVSLALVLRYLATGEGYAAATASIVVKTLVLYTIMVTGAIWEKVVFGQYLFAPAFFWEDVFSMLVLALHTAYLVALFTGALSPRGQMLLALAAYAAYVINAAQFLLKLRM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	139 (138)
Sequences:	1581 (796)
Seq/√Len:	67.8
META:	0.886

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_V	59_V	4.183	1.00
61_Y	99_T	3.465	1.00
12_S	73_V	3.012	1.00
44_E	47_A	2.806	1.00
39_Y	116_M	2.707	1.00
68_A	77_Q	2.395	1.00
48_A	51_A	2.341	1.00
46_Y	112_P	2.297	1.00
7_A	11_A	2.258	1.00
110_L	118_L	2.252	1.00
69_I	73_V	2.230	1.00
47_A	51_A	2.223	1.00
111_S	114_G	2.188	1.00
104_A	118_L	2.175	1.00
89_V	93_L	2.101	1.00
54_V	102_L	2.040	1.00
39_Y	46_Y	1.977	1.00
46_Y	50_T	1.884	1.00
104_A	110_L	1.870	1.00
104_A	115_Q	1.822	1.00
80_F	92_M	1.815	1.00
5_E	82_P	1.808	1.00
113_R	117_L	1.795	1.00
68_A	95_L	1.747	1.00
37_L	41_A	1.711	1.00
58_L	62_T	1.695	1.00
103_V	107_T	1.650	0.99
59_V	62_T	1.642	0.99
16_L	20_V	1.641	0.99
53_I	105_L	1.617	0.99
68_A	78_Y	1.613	0.99
103_V	109_A	1.593	0.99
85_F	89_V	1.571	0.99
110_L	114_G	1.546	0.99
131_A	135_L	1.541	0.99
30_L	34_A	1.539	0.99
50_T	115_Q	1.538	0.99
114_G	118_L	1.536	0.99
100_A	118_L	1.470	0.99
38_R	45_G	1.459	0.98
61_Y	102_L	1.416	0.98
107_T	110_L	1.377	0.98
2_T	5_E	1.362	0.98
28_V	55_V	1.351	0.97
29_F	33_L	1.346	0.97
105_L	115_Q	1.335	0.97
13_V	16_L	1.311	0.97
24_L	59_V	1.234	0.96
90_F	93_L	1.233	0.96
39_Y	50_T	1.225	0.96
29_F	127_V	1.223	0.95
90_F	128_I	1.214	0.95
26_F	29_F	1.189	0.95
110_L	115_Q	1.171	0.94
4_E	7_A	1.151	0.94
50_T	105_L	1.143	0.94
55_V	59_V	1.143	0.94
54_V	59_V	1.138	0.93
73_V	77_Q	1.103	0.92
72_K	75_F	1.097	0.92
36_V	116_M	1.090	0.92
30_L	33_L	1.089	0.92
50_T	53_I	1.086	0.92
53_I	101_Y	1.070	0.91
90_F	125_A	1.064	0.91
38_R	44_E	1.060	0.91
77_Q	92_M	1.031	0.89
127_V	131_A	1.028	0.89
29_F	121_A	1.022	0.89
34_A	38_R	1.018	0.89
16_L	19_G	1.000	0.88
99_T	102_L	0.989	0.87
112_P	115_Q	0.943	0.85
114_G	117_L	0.924	0.84
90_F	95_L	0.917	0.83
92_M	95_L	0.908	0.82
82_P	85_F	0.904	0.82
69_I	72_K	0.899	0.82
13_V	73_V	0.878	0.80
31_V	48_A	0.874	0.80
77_Q	83_A	0.872	0.80
47_A	50_T	0.869	0.80
90_F	137_L	0.855	0.78
93_L	125_A	0.844	0.78
103_V	106_F	0.843	0.77
100_A	104_A	0.835	0.77
13_V	69_I	0.834	0.77
5_E	8_R	0.832	0.77
73_V	90_F	0.827	0.76
115_Q	118_L	0.818	0.75
38_R	42_T	0.817	0.75
131_A	134_L	0.816	0.75
98_H	120_L	0.813	0.75
100_A	110_L	0.797	0.73
90_F	131_A	0.796	0.73
12_S	16_L	0.795	0.73
51_A	55_V	0.788	0.73
117_L	121_A	0.787	0.72
68_A	83_A	0.784	0.72
104_A	109_A	0.780	0.72
104_A	114_G	0.779	0.72
121_A	127_V	0.774	0.71
77_Q	82_P	0.774	0.71
58_L	106_F	0.767	0.71
72_K	90_F	0.764	0.70
5_E	76_G	0.763	0.70
23_P	127_V	0.735	0.67
118_L	122_A	0.731	0.67
95_L	102_L	0.724	0.66
20_V	24_L	0.723	0.66
93_L	121_A	0.723	0.66
6_R	10_D	0.718	0.65
11_A	73_V	0.705	0.64
121_A	124_A	0.705	0.64
129_N	132_Q	0.704	0.64
54_V	105_L	0.702	0.64
55_V	58_L	0.694	0.63
45_G	49_A	0.689	0.62
59_V	95_L	0.688	0.62
46_Y	116_M	0.687	0.62
50_T	116_M	0.686	0.62
48_A	55_V	0.683	0.62
34_A	41_A	0.671	0.60
64_M	79_L	0.669	0.60
13_V	20_V	0.669	0.60
106_F	109_A	0.666	0.60
59_V	111_S	0.664	0.59
100_A	103_V	0.663	0.59
29_F	90_F	0.663	0.59
85_F	92_M	0.660	0.59
50_T	106_F	0.660	0.59
7_A	13_V	0.658	0.59
69_I	75_F	0.655	0.58
57_T	91_S	0.651	0.58
104_A	116_M	0.648	0.58
46_Y	115_Q	0.648	0.58
80_F	89_V	0.644	0.57
18_Q	21_L	0.644	0.57
64_M	91_S	0.640	0.57
39_Y	112_P	0.639	0.56
72_K	76_G	0.633	0.56
108_G	111_S	0.633	0.56
125_A	131_A	0.633	0.56
40_L	113_R	0.627	0.55
38_R	41_A	0.626	0.55
1_Y	5_E	0.626	0.55
65_V	68_A	0.620	0.54
110_L	117_L	0.619	0.54
91_S	119_A	0.618	0.54
69_I	78_Y	0.616	0.54
60_L	63_I	0.614	0.54
16_L	23_P	0.610	0.53
54_V	58_L	0.608	0.53
33_L	127_V	0.607	0.53
33_L	59_V	0.606	0.53
79_L	91_S	0.602	0.52
51_A	103_V	0.601	0.52
92_M	96_A	0.600	0.52
7_A	72_K	0.600	0.52
126_Y	129_N	0.596	0.51
3_P	7_A	0.596	0.51
5_E	77_Q	0.596	0.51
33_L	37_L	0.585	0.50
35_L	38_R	0.582	0.50
13_V	17_V	0.571	0.48
45_G	48_A	0.569	0.48
33_L	53_I	0.569	0.48
68_A	90_F	0.565	0.48
20_V	127_V	0.564	0.48
24_L	85_F	0.563	0.47
65_V	95_L	0.560	0.47
48_A	113_R	0.559	0.47
27_L	77_Q	0.559	0.47
122_A	125_A	0.556	0.47
50_T	101_Y	0.556	0.47
50_T	107_T	0.550	0.46
27_L	37_L	0.548	0.46
7_A	106_F	0.546	0.45
101_Y	105_L	0.544	0.45
20_V	122_A	0.543	0.45
35_L	52_S	0.537	0.44
27_L	59_V	0.537	0.44
54_V	119_A	0.536	0.44
90_F	94_V	0.534	0.44
50_T	62_T	0.531	0.44
4_E	58_L	0.529	0.43
61_Y	96_A	0.527	0.43
6_R	11_A	0.526	0.43
107_T	114_G	0.525	0.43
58_L	95_L	0.523	0.43
111_S	125_A	0.522	0.43
68_A	92_M	0.522	0.43
34_A	58_L	0.521	0.42
78_Y	117_L	0.518	0.42
5_E	13_V	0.517	0.42
34_A	59_V	0.516	0.42
14_W	22_A	0.516	0.42
94_V	102_L	0.513	0.42
91_S	130_A	0.510	0.41
118_L	121_A	0.509	0.41
51_A	78_Y	0.507	0.41
13_V	103_V	0.505	0.41
106_F	113_R	0.504	0.41
107_T	111_S	0.502	0.40
36_V	120_L	0.501	0.40
40_L	116_M	0.500	0.40
64_M	94_V	0.500	0.40

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4v194	1	0	9.8	0.961	Contact Map
4om9A	1	0.2302	6	0.965	Contact Map
1xwjB	1	0.1727	5.3	0.966	Contact Map
1vdaA	1	0.0863	3.8	0.968	Contact Map
3szeA	1	0.2518	2.3	0.971	Contact Map
3j5pB	3	0.9424	2	0.972	Contact Map
2lx0A	1	0.2302	2	0.972	Contact Map
4ne2A	2	0.3381	1.8	0.973	Contact Map
4j2lC	1	0.1583	1.7	0.973	Contact Map
3tqcA	2	0.3453	1.7	0.973	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.