HemY_N - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HemY_N - HemY protein N-terminus

PFAM:	PF07219	Sequences: GYVLIVWGGYRIETSLNVAVLALLLLFVLLYLLLRLLRALLRLPRRVRRWRRRRRRRRGRAALTRGLIALAEGDWARAEKLAARAARLLEAPPLALLLAAQAAQLQG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	107 (106)
Sequences:	12349 (7907)
Seq/√Len:	767.9
META:	0.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
27_F	31_Y	2.939	1.00
3_V	19_A	2.784	1.00
79_E	106_Q	2.176	1.00
14_T	18_V	2.107	1.00
65_R	81_L	2.006	1.00
53_R	57_R	1.961	1.00
6_V	11_R	1.903	1.00
74_D	77_R	1.890	1.00
69_A	74_D	1.890	1.00
31_Y	34_L	1.867	1.00
31_Y	35_R	1.863	1.00
61_A	65_R	1.800	1.00
79_E	83_A	1.776	1.00
77_R	81_L	1.764	1.00
35_R	39_A	1.748	1.00
4_L	13_E	1.737	1.00
4_L	11_R	1.711	1.00
69_A	81_L	1.708	1.00
37_L	41_L	1.683	1.00
5_I	19_A	1.583	1.00
39_A	46_R	1.541	1.00
70_L	98_L	1.521	1.00
59_G	85_A	1.514	1.00
2_Y	13_E	1.504	1.00
18_V	22_A	1.478	1.00
38_R	42_R	1.457	1.00
15_S	18_V	1.411	1.00
68_I	72_E	1.405	1.00
27_F	30_L	1.381	1.00
35_R	38_R	1.376	1.00
82_A	98_L	1.340	1.00
63_L	95_A	1.312	1.00
2_Y	6_V	1.308	1.00
81_L	84_R	1.305	1.00
75_W	102_A	1.305	1.00
47_V	51_R	1.267	1.00
7_W	16_L	1.252	1.00
41_L	44_P	1.234	1.00
23_L	27_F	1.227	1.00
64_T	68_I	1.219	1.00
53_R	56_R	1.214	1.00
56_R	60_R	1.210	1.00
50_W	53_R	1.205	1.00
84_R	88_L	1.180	1.00
22_A	26_L	1.173	1.00
66_G	82_A	1.170	1.00
49_R	53_R	1.167	1.00
42_R	46_R	1.167	1.00
39_A	43_L	1.164	1.00
99_A	102_A	1.164	1.00
28_V	32_L	1.151	1.00
14_T	19_A	1.151	1.00
26_L	30_L	1.140	1.00
86_A	99_A	1.118	1.00
83_A	86_A	1.111	1.00
101_Q	105_L	1.097	1.00
59_G	89_L	1.071	1.00
27_F	34_L	1.046	1.00
82_A	102_A	1.019	1.00
85_A	95_A	1.018	1.00
62_A	85_A	1.016	1.00
44_P	47_V	1.010	1.00
66_G	78_A	1.004	1.00
45_R	49_R	0.999	1.00
83_A	87_R	0.997	1.00
55_R	88_L	0.985	1.00
48_R	52_R	0.969	1.00
40_L	44_P	0.943	1.00
34_L	38_R	0.942	1.00
57_R	61_A	0.941	1.00
76_A	79_E	0.938	1.00
51_R	55_R	0.935	1.00
46_R	49_R	0.922	1.00
50_W	54_R	0.918	1.00
69_A	77_R	0.918	1.00
19_A	23_L	0.914	1.00
46_R	50_W	0.904	1.00
62_A	84_R	0.891	1.00
52_R	56_R	0.891	1.00
71_A	101_Q	0.882	1.00
60_R	90_E	0.881	1.00
86_A	90_E	0.877	1.00
70_L	105_L	0.860	1.00
62_A	81_L	0.857	1.00
60_R	64_T	0.847	1.00
25_L	28_V	0.843	1.00
58_R	61_A	0.832	1.00
101_Q	104_Q	0.826	1.00
75_W	79_E	0.796	1.00
68_I	71_A	0.790	1.00
6_V	9_G	0.776	1.00
70_L	78_A	0.758	1.00
47_V	50_W	0.754	1.00
66_G	70_L	0.750	1.00
91_A	94_L	0.741	1.00
4_L	8_G	0.740	1.00
14_T	22_A	0.735	1.00
93_P	96_L	0.729	1.00
7_W	17_N	0.716	1.00
31_Y	38_R	0.714	1.00
89_L	92_P	0.707	1.00
10_Y	14_T	0.705	1.00
54_R	58_R	0.698	1.00
39_A	42_R	0.688	1.00
91_A	95_A	0.687	1.00
36_L	40_L	0.687	1.00
93_P	104_Q	0.683	1.00
92_P	95_A	0.681	1.00
32_L	36_L	0.675	1.00
13_E	17_N	0.672	1.00
70_L	102_A	0.667	1.00
63_L	67_L	0.663	1.00
43_L	47_V	0.662	1.00
18_V	21_L	0.656	1.00
45_R	48_R	0.655	1.00
8_G	11_R	0.655	1.00
33_L	37_L	0.655	1.00
5_I	12_I	0.654	1.00
17_N	20_V	0.653	1.00
59_G	95_A	0.650	1.00
43_L	46_R	0.639	1.00
34_L	37_L	0.637	1.00
96_L	99_A	0.630	1.00
8_G	12_I	0.622	1.00
8_G	16_L	0.617	1.00
51_R	54_R	0.616	1.00
81_L	85_A	0.603	1.00
4_L	15_S	0.601	1.00
10_Y	22_A	0.598	1.00
22_A	25_L	0.596	1.00
67_L	94_L	0.594	1.00
86_A	96_L	0.594	1.00
3_V	16_L	0.591	1.00
58_R	88_L	0.585	1.00
8_G	14_T	0.579	1.00
40_L	43_L	0.574	1.00
59_G	62_A	0.561	1.00
30_L	34_L	0.553	1.00
28_V	31_Y	0.550	1.00
49_R	52_R	0.550	1.00
14_T	17_N	0.546	1.00
64_T	91_A	0.544	1.00
5_I	16_L	0.543	1.00
5_I	8_G	0.540	1.00
7_W	12_I	0.538	1.00
17_N	21_L	0.532	1.00
98_L	105_L	0.530	1.00
24_L	28_V	0.525	1.00
59_G	88_L	0.523	1.00
34_L	42_R	0.520	1.00
47_V	54_R	0.519	1.00
9_G	14_T	0.514	1.00
32_L	35_R	0.511	1.00
79_E	103_A	0.510	1.00
63_L	70_L	0.509	1.00
66_G	98_L	0.507	1.00
99_A	103_A	0.507	1.00
86_A	89_L	0.506	1.00
42_R	45_R	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4cgwA	1	0.5981	80.7	0.792	Contact Map
4bujB	1	0.5047	78.7	0.796	Contact Map
2xevA	1	0.4579	76.8	0.8	Contact Map
1w3bA	2	0.4393	75.8	0.802	Contact Map
2c2lA	1	0.486	75	0.803	Contact Map
2gw1A	2	0.4953	75	0.803	Contact Map
3urzA	1	0.4766	74.9	0.803	Contact Map
2kc7A	1	0.4486	74.9	0.803	Contact Map
4u04A	2	0.4673	73.6	0.805	Contact Map
4i2zA	1	0.486	73.4	0.805	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.