SF3b10 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SF3b10 - Splicing factor 3B subunit 10 (SF3b10)

PFAM:	PF07189	Sequences: DRYNIQSQLEHLQAKYVGTGHADTTKFEWATNQHRDTYASYIGHPDLLSYFAIAENESIGRVRFNLLEKMLQPCGPPP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	78 (78)
Sequences:	546 (331)
Seq/√Len:	37.4
META:	0.559

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_T	41_Y	3.742	1.00
72_Q	76_P	3.256	1.00
30_A	33_Q	3.181	1.00
40_S	44_H	2.977	1.00
58_S	61_R	2.284	0.99
41_Y	47_L	2.197	0.99
38_Y	66_L	1.967	0.98
75_G	78_P	1.957	0.98
48_L	63_R	1.948	0.98
41_Y	51_F	1.945	0.98
57_E	65_N	1.902	0.98
27_F	31_T	1.874	0.98
37_T	51_F	1.769	0.97
55_E	65_N	1.764	0.97
60_G	63_R	1.748	0.97
11_H	15_K	1.612	0.95
49_S	59_I	1.478	0.92
60_G	64_F	1.453	0.91
30_A	34_H	1.453	0.91
38_Y	41_Y	1.375	0.88
17_V	32_N	1.363	0.88
49_S	52_A	1.337	0.87
13_Q	32_N	1.311	0.86
71_L	77_P	1.205	0.81
67_L	72_Q	1.196	0.80
45_P	49_S	1.161	0.78
2_R	6_Q	1.156	0.78
64_F	68_E	1.138	0.77
8_Q	12_L	1.118	0.76
45_P	59_I	1.097	0.74
6_Q	9_L	1.082	0.73
14_A	30_A	1.073	0.72
46_D	49_S	1.048	0.71
2_R	5_I	1.046	0.70
13_Q	19_T	1.033	0.70
19_T	29_W	1.025	0.69
48_L	62_V	1.013	0.68
25_T	28_E	0.999	0.67
66_L	69_K	0.994	0.67
42_I	67_L	0.969	0.65
62_V	65_N	0.965	0.64
52_A	62_V	0.959	0.64
42_I	49_S	0.958	0.64
38_Y	69_K	0.939	0.62
5_I	51_F	0.931	0.61
33_Q	47_L	0.923	0.61
31_T	57_E	0.922	0.61
48_L	69_K	0.918	0.60
74_C	78_P	0.886	0.58
34_H	69_K	0.886	0.58
51_F	66_L	0.865	0.56
3_Y	6_Q	0.862	0.55
50_Y	54_A	0.859	0.55
26_K	68_E	0.855	0.55
13_Q	17_V	0.854	0.55
46_D	66_L	0.839	0.53
8_Q	11_H	0.810	0.51
4_N	7_S	0.785	0.49
48_L	76_P	0.773	0.48
25_T	48_L	0.773	0.48
15_K	21_H	0.772	0.47
9_L	13_Q	0.771	0.47
24_T	39_A	0.768	0.47
68_E	72_Q	0.756	0.46
27_F	47_L	0.736	0.44
65_N	69_K	0.728	0.44
20_G	40_S	0.721	0.43
14_A	57_E	0.710	0.42
27_F	76_P	0.705	0.42
22_A	31_T	0.702	0.41
62_V	66_L	0.700	0.41
1_D	4_N	0.695	0.41
17_V	43_G	0.691	0.40
41_Y	66_L	0.684	0.40
13_Q	29_W	0.679	0.39
15_K	18_G	0.673	0.39
55_E	62_V	0.668	0.38
10_E	13_Q	0.657	0.38
2_R	8_Q	0.654	0.37
72_Q	77_P	0.642	0.36
27_F	68_E	0.638	0.36
16_Y	19_T	0.632	0.35
35_R	40_S	0.629	0.35
7_S	41_Y	0.628	0.35
15_K	56_N	0.626	0.35
27_F	46_D	0.626	0.35
20_G	67_L	0.622	0.35
35_R	43_G	0.617	0.34
11_H	14_A	0.610	0.34
52_A	59_I	0.609	0.34
20_G	32_N	0.605	0.33
27_F	56_N	0.603	0.33
48_L	77_P	0.601	0.33
9_L	12_L	0.600	0.33
31_T	47_L	0.598	0.33
34_H	66_L	0.595	0.33
29_W	68_E	0.588	0.32
60_G	67_L	0.570	0.31
4_N	60_G	0.565	0.30
18_G	29_W	0.561	0.30
57_E	72_Q	0.559	0.30
29_W	64_F	0.554	0.29
51_F	62_V	0.552	0.29
17_V	26_K	0.538	0.28
53_I	59_I	0.537	0.28
7_S	11_H	0.529	0.28
34_H	71_L	0.528	0.28
8_Q	16_Y	0.525	0.27
1_D	6_Q	0.523	0.27
3_Y	33_Q	0.522	0.27
1_D	24_T	0.519	0.27
48_L	65_N	0.518	0.27
3_Y	24_T	0.517	0.27
16_Y	24_T	0.517	0.27
10_E	18_G	0.514	0.27
59_I	64_F	0.508	0.26
26_K	30_A	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1jqnA	3	0.8846	12.2	0.924	Contact Map
4s0vA	1	0.9103	7.4	0.931	Contact Map
2i06A	1	0.9872	7.4	0.931	Contact Map
4gfjA	1	0.8974	5.8	0.935	Contact Map
2q88A	1	0.4103	5.2	0.936	Contact Map
3t5tA	2	0.8718	3.5	0.941	Contact Map
2p7nA	2	0.9359	3.4	0.941	Contact Map
3froA	3	0.9103	3.4	0.941	Contact Map
4oqrA	1	0.0385	2.8	0.944	Contact Map
4bxhA	3	0.8462	2.8	0.944	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.