DUF1360 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1360 - Protein of unknown function (DUF1360)

PFAM:	PF07098	Sequences: LLGLATFKLSRLIAKDKVTSPLRAPFTEYEGDAGPGEVEEEPRPKGGGLRRAIGELLTCPFCLGTWVAAGLVAGLVLAPRATRLVAAVLAAAAVADFLQAAY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	102 (98)
Sequences:	3859 (2386)
Seq/√Len:	241.0
META:	0.906

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
3_G	94_V	4.333	1.00
30_E	41_E	2.757	1.00
74_G	82_T	2.707	1.00
14_A	63_L	2.601	1.00
6_T	68_A	2.562	1.00
9_L	89_L	2.511	1.00
78_A	81_A	2.379	1.00
10_S	14_A	2.095	1.00
4_L	90_A	2.056	1.00
7_F	93_A	1.967	1.00
85_V	89_L	1.912	1.00
64_G	92_A	1.890	1.00
72_V	84_L	1.862	1.00
33_A	39_E	1.836	1.00
71_L	86_A	1.789	1.00
19_T	22_L	1.789	1.00
12_L	18_V	1.777	1.00
59_C	62_C	1.674	1.00
28_E	41_E	1.659	1.00
89_L	92_A	1.644	1.00
9_L	67_V	1.493	1.00
65_T	92_A	1.468	1.00
65_T	89_L	1.460	1.00
26_F	53_I	1.437	1.00
76_V	84_L	1.431	1.00
72_V	88_V	1.423	1.00
16_D	19_T	1.420	1.00
93_A	97_F	1.389	1.00
46_G	50_R	1.290	1.00
29_Y	40_E	1.283	1.00
81_A	84_L	1.264	1.00
17_K	32_D	1.261	1.00
6_T	67_V	1.260	1.00
12_L	19_T	1.216	1.00
17_K	55_E	1.193	1.00
72_V	76_V	1.183	1.00
63_L	67_V	1.146	1.00
64_G	95_A	1.146	1.00
21_P	25_P	1.132	1.00
49_L	53_I	1.123	1.00
8_K	16_D	1.122	1.00
25_P	54_G	1.111	1.00
72_V	87_A	1.084	1.00
11_R	16_D	1.049	1.00
15_K	60_P	1.031	1.00
29_Y	32_D	1.030	1.00
18_V	23_R	1.021	1.00
72_V	75_L	1.017	1.00
26_F	54_G	0.992	1.00
61_F	100_A	0.982	1.00
22_L	25_P	0.977	1.00
11_R	15_K	0.972	1.00
34_G	37_E	0.967	1.00
47_G	51_R	0.964	1.00
49_L	52_A	0.954	1.00
46_G	51_R	0.945	1.00
74_G	78_A	0.938	1.00
48_G	51_R	0.930	1.00
27_T	58_T	0.921	1.00
29_Y	38_V	0.916	1.00
96_D	99_Q	0.915	1.00
13_I	63_L	0.899	1.00
90_A	93_A	0.896	1.00
9_L	71_L	0.858	0.99
51_R	55_E	0.849	0.99
2_L	75_L	0.837	0.99
69_A	73_A	0.837	0.99
69_A	88_V	0.831	0.99
35_P	100_A	0.827	0.99
2_L	71_L	0.823	0.99
86_A	91_A	0.814	0.99
42_P	51_R	0.814	0.99
97_F	100_A	0.795	0.99
92_A	95_A	0.786	0.99
13_I	67_V	0.785	0.99
2_L	91_A	0.784	0.99
64_G	68_A	0.767	0.99
75_L	91_A	0.764	0.99
7_F	99_Q	0.761	0.98
20_S	24_A	0.761	0.98
57_L	63_L	0.753	0.98
11_R	60_P	0.746	0.98
90_A	94_V	0.737	0.98
65_T	72_V	0.725	0.98
73_A	77_L	0.717	0.98
68_A	92_A	0.707	0.98
17_K	20_S	0.698	0.97
72_V	91_A	0.697	0.97
34_G	73_A	0.694	0.97
47_G	50_R	0.693	0.97
17_K	61_F	0.692	0.97
88_V	92_A	0.688	0.97
59_C	66_W	0.687	0.97
5_A	86_A	0.683	0.97
10_S	61_F	0.682	0.97
19_T	23_R	0.676	0.97
10_S	64_G	0.673	0.97
8_K	11_R	0.665	0.96
61_F	65_T	0.656	0.96
73_A	88_V	0.651	0.96
81_A	87_A	0.644	0.96
7_F	64_G	0.643	0.96
31_G	34_G	0.639	0.96
20_S	29_Y	0.637	0.95
58_T	61_F	0.636	0.95
14_A	60_P	0.626	0.95
88_V	91_A	0.625	0.95
74_G	80_R	0.624	0.95
43_R	46_G	0.621	0.95
64_G	99_Q	0.621	0.95
12_L	16_D	0.620	0.95
42_P	58_T	0.619	0.95
31_G	39_E	0.618	0.95
29_Y	33_A	0.618	0.95
74_G	85_V	0.612	0.94
8_K	92_A	0.604	0.94
10_S	95_A	0.598	0.94
1_L	86_A	0.596	0.94
71_L	75_L	0.591	0.93
32_D	35_P	0.590	0.93
54_G	58_T	0.587	0.93
61_F	96_D	0.582	0.93
19_T	25_P	0.573	0.92
12_L	65_T	0.572	0.92
10_S	15_K	0.572	0.92
22_L	57_L	0.570	0.92
28_E	33_A	0.570	0.92
61_F	92_A	0.557	0.91
65_T	69_A	0.555	0.91
75_L	86_A	0.554	0.91
94_V	97_F	0.552	0.91
82_T	87_A	0.548	0.90
86_A	93_A	0.546	0.90
30_E	39_E	0.535	0.89
17_K	21_P	0.533	0.89
84_L	87_A	0.533	0.89
75_L	87_A	0.527	0.89
80_R	83_R	0.524	0.88
62_C	66_W	0.519	0.88
84_L	88_V	0.516	0.88
91_A	94_V	0.509	0.87
77_L	84_L	0.507	0.87
5_A	71_L	0.506	0.87
26_F	57_L	0.503	0.86
16_D	96_D	0.502	0.86
68_A	72_V	0.500	0.86
89_L	93_A	0.500	0.86

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2l34A	2	0.1176	6.3	0.907	Contact Map
4eneA	2	0.3333	4.2	0.915	Contact Map
4q9hA	1	1	3.9	0.916	Contact Map
3nd0A	2	0.3137	3.2	0.919	Contact Map
4wfiA	1	0.5392	2.6	0.923	Contact Map
4f4cA	1	0.9608	2.2	0.926	Contact Map
1j4nA	4	0.2647	2	0.928	Contact Map
4mwaA	4	0.4902	1.9	0.929	Contact Map
3wmgA	1	0.9804	1.9	0.929	Contact Map
4xp4A	1	0.2843	1.7	0.931	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.