DUF1351 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1351 - Protein of unknown function (DUF1351)

PFAM:	PF07083	Sequences: ELQVEQTPAVIEFNFEELKAELEEKLEKYKGLVVTEDTIKEAKKDRAELNKLKKALEDKRKEIKKEYLAPYEEFEAQVKELIALIDEAIDKIDEQVKEFEEKRKEEKREEIKEYFEEKIGELGLDFEKIEFDDKWLNKTTSLKKIKEEIEDAKIEKIKKDLEEIEALKSEIEEKAKAYYLEAEDYIRLLKEGKDLAEILKEIKADEEQKK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	210 (193)
Sequences:	1251 (1049)
Seq/√Len:	75.5
META:	0.823

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
59_K	62_E	4.269	1.00
93_D	97_K	3.922	1.00
57_E	61_K	3.915	1.00
53_K	86_D	3.529	1.00
75_E	79_K	3.189	1.00
64_K	75_E	3.187	1.00
54_K	58_D	3.048	1.00
66_E	69_A	2.641	1.00
23_E	84_L	2.619	1.00
101_E	105_E	2.611	1.00
19_K	80_E	2.592	1.00
143_K	147_E	2.505	1.00
57_E	60_R	2.464	1.00
46_R	50_N	2.314	1.00
141_S	144_K	2.305	1.00
57_E	82_I	2.267	1.00
102_K	106_E	2.083	1.00
14_N	17_E	2.020	1.00
105_E	109_E	1.984	1.00
49_L	85_I	1.890	1.00
52_L	85_I	1.889	1.00
26_L	84_L	1.885	1.00
156_K	160_D	1.845	1.00
61_K	65_K	1.837	1.00
19_K	84_L	1.836	1.00
15_F	77_Q	1.800	1.00
131_F	136_L	1.772	1.00
110_E	142_L	1.724	1.00
50_N	89_I	1.700	1.00
103_R	138_K	1.695	1.00
132_D	148_E	1.685	1.00
112_K	116_E	1.682	1.00
68_L	72_E	1.673	1.00
27_E	30_K	1.669	1.00
105_E	108_R	1.622	1.00
64_K	71_Y	1.613	1.00
69_A	73_E	1.612	1.00
40_K	44_K	1.602	1.00
22_L	26_L	1.594	0.99
68_L	71_Y	1.590	0.99
111_I	145_I	1.557	0.99
46_R	93_D	1.533	0.99
42_A	92_I	1.532	0.99
15_F	81_L	1.531	0.99
47_A	50_N	1.524	0.99
22_L	81_L	1.524	0.99
73_E	77_Q	1.513	0.99
19_K	23_E	1.485	0.99
96_V	103_R	1.472	0.99
164_I	167_L	1.463	0.99
58_D	61_K	1.431	0.99
108_R	112_K	1.425	0.99
140_T	144_K	1.423	0.99
124_L	157_I	1.415	0.99
58_D	62_E	1.360	0.98
35_T	38_T	1.350	0.98
51_K	54_K	1.345	0.98
98_E	102_K	1.344	0.98
67_Y	71_Y	1.339	0.98
34_V	42_A	1.315	0.98
7_T	10_V	1.308	0.98
174_K	177_A	1.288	0.98
30_K	87_E	1.264	0.97
185_Y	188_L	1.258	0.97
34_V	45_D	1.231	0.97
109_E	112_K	1.229	0.97
194_D	197_E	1.225	0.97
140_T	145_I	1.199	0.96
57_E	71_Y	1.199	0.96
156_K	159_K	1.184	0.96
163_E	167_L	1.181	0.96
46_R	89_I	1.177	0.96
118_K	151_D	1.144	0.95
129_I	135_W	1.142	0.95
106_E	110_E	1.139	0.95
144_K	147_E	1.131	0.95
191_E	194_D	1.120	0.95
114_Y	146_K	1.118	0.95
46_R	96_V	1.108	0.94
110_E	113_E	1.107	0.94
147_E	152_A	1.100	0.94
51_K	55_A	1.093	0.94
72_E	75_E	1.069	0.93
63_I	71_Y	1.057	0.93
115_F	125_D	1.046	0.92
54_K	61_K	1.037	0.92
167_L	170_E	1.035	0.92
47_A	51_K	1.028	0.92
151_D	155_E	1.024	0.92
185_Y	189_L	1.016	0.91
65_K	72_E	1.015	0.91
172_E	176_K	1.014	0.91
114_Y	151_D	1.008	0.91
107_K	142_L	1.008	0.91
57_E	75_E	0.994	0.90
79_K	82_I	0.978	0.90
25_K	28_K	0.975	0.89
190_K	194_D	0.971	0.89
86_D	89_I	0.970	0.89
170_E	176_K	0.969	0.89
64_K	68_L	0.967	0.89
36_E	99_F	0.960	0.89
80_E	84_L	0.958	0.89
88_A	91_K	0.957	0.89
90_D	94_E	0.947	0.88
60_R	75_E	0.936	0.87
69_A	72_E	0.930	0.87
159_K	162_E	0.926	0.87
152_A	156_K	0.920	0.86
193_K	198_I	0.917	0.86
83_A	87_E	0.911	0.86
158_K	162_E	0.910	0.86
53_K	89_I	0.898	0.85
9_A	67_Y	0.894	0.85
78_V	85_I	0.888	0.84
140_T	148_E	0.883	0.84
47_A	93_D	0.882	0.84
153_K	156_K	0.881	0.84
187_R	190_K	0.871	0.83
56_L	85_I	0.863	0.83
179_Y	185_Y	0.848	0.82
31_G	91_K	0.844	0.81
194_D	199_L	0.839	0.81
33_V	38_T	0.839	0.81
70_P	74_F	0.836	0.81
74_F	78_V	0.835	0.81
193_K	197_E	0.830	0.80
38_T	41_E	0.828	0.80
72_E	76_A	0.827	0.80
132_D	135_W	0.822	0.80
104_K	136_L	0.822	0.80
169_S	172_E	0.821	0.80
15_F	19_K	0.818	0.79
8_P	13_F	0.816	0.79
56_L	78_V	0.813	0.79
139_T	144_K	0.803	0.78
189_L	193_K	0.790	0.77
49_L	92_I	0.788	0.77
22_L	84_L	0.787	0.77
60_R	82_I	0.785	0.76
22_L	52_L	0.780	0.76
168_K	172_E	0.778	0.76
13_F	77_Q	0.775	0.75
44_K	48_E	0.771	0.75
162_E	165_E	0.768	0.75
19_K	77_Q	0.751	0.73
53_K	82_I	0.750	0.73
171_I	174_K	0.747	0.73
135_W	148_E	0.744	0.72
134_K	137_N	0.743	0.72
50_N	86_D	0.736	0.72
172_E	177_A	0.727	0.71
34_V	99_F	0.727	0.71
77_Q	81_L	0.726	0.71
16_E	77_Q	0.726	0.71
82_I	85_I	0.722	0.70
25_K	52_L	0.721	0.70
182_A	186_I	0.720	0.70
71_Y	75_E	0.716	0.70
46_R	100_E	0.715	0.69
179_Y	182_A	0.715	0.69
24_E	27_E	0.714	0.69
117_E	146_K	0.711	0.69
95_Q	99_F	0.707	0.69
44_K	51_K	0.702	0.68
194_D	198_I	0.702	0.68
181_E	185_Y	0.696	0.67
39_I	99_F	0.696	0.67
189_L	198_I	0.695	0.67
154_I	158_K	0.694	0.67
34_V	92_I	0.689	0.67
59_K	63_I	0.688	0.67
186_I	198_I	0.688	0.67
170_E	174_K	0.685	0.66
164_I	169_S	0.683	0.66
29_Y	49_L	0.682	0.66
120_G	123_G	0.681	0.66
89_I	93_D	0.675	0.65
173_E	177_A	0.675	0.65
196_A	199_L	0.672	0.65
6_Q	9_A	0.672	0.65
53_K	57_E	0.668	0.64
42_A	45_D	0.668	0.64
167_L	171_I	0.668	0.64
163_E	166_A	0.667	0.64
84_L	92_I	0.666	0.64
188_L	194_D	0.660	0.63
23_E	27_E	0.656	0.63
181_E	184_D	0.655	0.63
101_E	104_K	0.650	0.62
57_E	64_K	0.649	0.62
15_F	22_L	0.648	0.62
57_E	78_V	0.647	0.62
107_K	141_S	0.646	0.62
173_E	176_K	0.644	0.61
103_R	106_E	0.642	0.61
152_A	155_E	0.641	0.61
108_R	131_F	0.640	0.61
132_D	153_K	0.638	0.61
5_E	12_E	0.636	0.60
18_L	22_L	0.634	0.60
84_L	88_A	0.630	0.60
45_D	48_E	0.629	0.60
164_I	168_K	0.624	0.59
97_K	103_R	0.622	0.59
171_I	175_A	0.621	0.59
126_F	131_F	0.620	0.59
63_I	74_F	0.619	0.58
190_K	193_K	0.619	0.58
50_N	93_D	0.618	0.58
49_L	89_I	0.615	0.58
109_E	113_E	0.613	0.58
16_E	20_A	0.613	0.58
22_L	85_I	0.611	0.57
184_D	188_L	0.608	0.57
108_R	133_D	0.606	0.57
98_E	101_E	0.604	0.57
14_N	29_Y	0.604	0.57
107_K	148_E	0.601	0.56
115_F	126_F	0.601	0.56
71_Y	78_V	0.600	0.56
122_L	154_I	0.600	0.56
61_K	71_Y	0.599	0.56
13_F	95_Q	0.598	0.56
17_E	20_A	0.596	0.56
179_Y	186_I	0.594	0.55
41_E	44_K	0.590	0.55
55_A	59_K	0.587	0.54
97_K	101_E	0.585	0.54
188_L	195_L	0.584	0.54
50_N	54_K	0.584	0.54
34_V	38_T	0.584	0.54
32_L	92_I	0.582	0.54
20_A	24_E	0.580	0.54
165_E	176_K	0.577	0.53
185_Y	191_E	0.577	0.53
155_E	159_K	0.576	0.53
24_E	28_K	0.575	0.53
113_E	116_E	0.573	0.53
164_I	170_E	0.569	0.52
29_Y	92_I	0.567	0.52
52_L	56_L	0.567	0.52
171_I	176_K	0.565	0.52
89_I	96_V	0.565	0.52
184_D	189_L	0.564	0.52
158_K	161_L	0.563	0.51
26_L	81_L	0.563	0.51
188_L	191_E	0.561	0.51
100_E	139_T	0.559	0.51
119_I	123_G	0.558	0.51
38_T	42_A	0.558	0.51
161_L	164_I	0.556	0.51
56_L	82_I	0.556	0.51
184_D	187_R	0.556	0.51
141_S	145_I	0.553	0.50
60_R	65_K	0.552	0.50
182_A	185_Y	0.549	0.50
196_A	200_K	0.549	0.50
90_D	93_D	0.548	0.50
134_K	140_T	0.547	0.49
125_D	128_K	0.542	0.49
18_L	49_L	0.537	0.48
197_E	200_K	0.536	0.48
36_E	39_I	0.534	0.48
172_E	175_A	0.532	0.48
34_V	95_Q	0.532	0.48
33_V	95_Q	0.532	0.48
20_A	94_E	0.532	0.48
153_K	157_I	0.529	0.47
22_L	88_A	0.528	0.47
60_R	74_F	0.526	0.47
81_L	85_I	0.526	0.47
188_L	193_K	0.526	0.47
134_K	144_K	0.524	0.47
185_Y	190_K	0.524	0.47
157_I	160_D	0.521	0.46
104_K	131_F	0.520	0.46
18_L	52_L	0.519	0.46
114_Y	149_I	0.519	0.46
121_E	158_K	0.517	0.46
18_L	85_I	0.516	0.46
190_K	196_A	0.515	0.45
13_F	18_L	0.515	0.45
187_R	191_E	0.514	0.45
76_A	83_A	0.509	0.45
131_F	137_N	0.509	0.45
115_F	129_I	0.507	0.44
50_N	53_K	0.506	0.44
36_E	103_R	0.503	0.44
193_K	199_L	0.500	0.44

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3ghgA	2	0.6714	26.5	0.926	Contact Map
1deqA	1	0.7619	24	0.928	Contact Map
2dfsA	2	0.5429	20	0.93	Contact Map
4j7oA	1	0.9286	8.7	0.941	Contact Map
2lemA	1	0.8476	7.2	0.943	Contact Map
4j2cA	1	0.3	6.9	0.943	Contact Map
2l7bA	1	0.6571	6.8	0.944	Contact Map
3mq9A	4	0.4619	6.4	0.944	Contact Map
4tqlA	1	0.3905	6.3	0.944	Contact Map
2q12A	2	0.7905	6	0.945	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.